
GPCR/G-Protein
GPCR/G-Protein inhibitors are compounds that target G-protein coupled receptors (GPCRs) and associated G-proteins, which play critical roles in transmitting signals from the outside to the inside of cells. These inhibitors are essential for studying the signaling pathways mediated by GPCRs, which are involved in numerous physiological processes, including sensory perception, immune response, and neurotransmission. GPCR inhibitors are also important in drug development, as many therapeutic agents target these receptors. At CymitQuimica, we offer a wide range of high-quality GPCR/G-Protein inhibitors to support your research in pharmacology, cell biology, and related fields.
Subcategories of "GPCR/G-Protein"
- 5-HT Receptor(942 products)
- Adenosine Receptor(242 products)
- Adrenergic Receptor(2,949 products)
- Bombesin Receptor(30 products)
- Bradykinin Receptor(59 products)
- CXCR(149 products)
- CaSR(32 products)
- Cannabinoid Receptor(195 products)
- Dopamine Receptor(410 products)
- Endothelin Receptor(75 products)
- GNRH Receptor(73 products)
- GPCR19(31 products)
- GRK(32 products)
- GTPase(21 products)
- Glucagon Receptor(166 products)
- Hedgehog/Smoothened(45 products)
- Histamine Receptor(359 products)
- LPA Receptor(21 products)
- Melatonin Receptor(24 products)
- OX Receptor(40 products)
- Opioid Receptor(298 products)
- PAFR(11 products)
- PKA(49 products)
- S1P Receptor(17 products)
- SGLT(30 products)
- Sigma receptor(46 products)
Show 18 more subcategories
Found 5378 products of "GPCR/G-Protein"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
17-TFM-PGF1α
CAS:<p>17-TFM-PGF1α (Compound 8) is a saturated prostaglandin analog. It exhibits a high affinity and receptor selectivity for the human prostaglandin F receptor (hFP receptor), with an EC50 of 85 nM.</p>Formula:C24H35F3O5Color and Shape:SolidMolecular weight:460.53BAY-6672
CAS:BAY-6672 is, a selective,oral, highly potent human prostaglandin F (FP) receptor antagonist, exerts antifibrotic effects by inhibiting PGF₂α activity.Formula:C26H27BrClN3O3Purity:99.51%Color and Shape:SolidMolecular weight:544.87Imnopitant dihydrochloride
CAS:<p>Imnopitant dihydrochloride is a neurokinin NK1 receptor antagonist [1] .</p>Formula:C28H30Cl2F6N4OColor and Shape:SolidMolecular weight:623.46Utreglutide
CAS:<p>Utreglutide is a potent glucagon-like peptide 1 (GLP-1) receptor agonit [1] .</p>Formula:C191H298N46O58Color and Shape:SolidMolecular weight:4166.67Substance P (4-11)
CAS:Substance P (4-11), a C-terminal fragment of Substance P, acts as a highly selective agonist for NK1 receptors, demonstrating specificity in its interaction.Formula:C46H67N11O10SColor and Shape:SolidMolecular weight:966.16MLGFFQQPKPR-NH2
CAS:<p>MLGFFQQPKPR-NH2 is a reversed Substance P peptide. Substance P is a neuropeptide [1] .</p>Formula:C63H98N18O13SColor and Shape:SolidMolecular weight:1347.63ANQ-11125 TFA
<p>ANQ-11125 TFA is a motilin antagonist with a pKd of 8.24, inhibiting motilide contractions in rabbits.</p>Formula:C88H126F3N19O23Color and Shape:SolidMolecular weight:1875.05Ecnoglutide
CAS:<p>Ecnoglutide (XW003) is a glucagon-like peptide 1 (GLP-1) receptor agonist [1] .</p>Formula:C194H304N48O61Color and Shape:SolidMolecular weight:4284.76Neuropeptide Y (18-36) (porcine)
CAS:<p>"Neuropeptide Y (18-36) (porcine) is a NPY heart receptor blocker, halts I-NPY binding, aids in heart failure research."</p>Formula:C112H174N36O27Color and Shape:SolidMolecular weight:2456.8Neuropeptide W-30 (rat)
CAS:<p>Neuropeptide W-30 (rat) acts as a crucial stress mediator within the central nervous system, influencing the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. It serves as an endogenous ligand for the two related orphan G-protein-coupled receptors (GPCRs), GPR7 and GPR8. NPW-30 binds and activates both GPR7 and GPR8 at comparable effective doses [1] [2] [3].</p>Formula:C165H249N49O38SColor and Shape:SolidMolecular weight:3559.11GLP-1(28-36)amide TFA
<p>GLP-1(28-36)amide TFA, a nonapeptide cleavage product of GLP-1, shows antioxidant properties with anti-diabetic and cardioprotective effects.</p>Formula:C56H86F3N15O11Color and Shape:SolidMolecular weight:1202.37BIM-23190 hydrochloride
<p>BIM-23190 hydrochloride, somatostatin analog, SSRT2/5 agonist, Ki: 0.34 nM (SSTR2), 11.1 nM (SSTR5). Used in cancer, acromegaly research.</p>Color and Shape:LiquidLH-RH (7-10)
CAS:LH-RH (7-10), a tetrapeptide, is a key LHRH degradation product found in macrophages and pneumocytes.Formula:C19H36N8O4Color and Shape:SolidMolecular weight:440.54Hemokinin 1, human TFA
<p>Hemokinin-1 is a human TFA and selective NK1 agonist; also activates NK2 & NK3 and induces opioid-independent analgesia.</p>Formula:C56H85F3N14O16SColor and Shape:SolidMolecular weight:1299.42(-)-Eseroline fumarate
CAS:<p>(-)-Eseroline fumarate, a Physostigmine metabolite and AChE inhibitor, triggers cancer cell LDH release and neuronal cell death.</p>Formula:C17H22N2O5Color and Shape:SolidMolecular weight:334.37JNJ-40929837 succinate
CAS:<p>JNJ-40929837 succinate is a selective, orally active inhibitor of LTA 4 H (leukotriene A 4 hydrolase). This compound effectively inhibits aminopeptidase activity, leading to the accumulation of Pro-Gly-Pro in serum, and can be utilized in asthma research [1].</p>Formula:C22H24N4O2S·xC4H6O4Color and Shape:SolidHuman growth hormone-releasing factor TFA
<p>Human growth hormone-releasing factor TFA is a hypothalamic peptide that promotes GH secretion by targeting pituitary GHRHR.</p>Formula:C217H359F3N72O68SColor and Shape:SolidMolecular weight:5153.67AZ7976
CAS:<p>AZ7976 (Compound 42), a potent and highly selective agonist for Relaxin Family Peptide Receptor 1 (RXFP1) with a pEC 50 value greater than 10.5, operates through an allosteric mechanism to enhance RXFP1's cAMP signaling, which physiologically elevates heart rate. This property makes AZ7976 a valuable tool in cardiovascular disease research [1].</p>Formula:C30H33F7N2O6SColor and Shape:SolidMolecular weight:682.65PAR 4 (1-6)
CAS:<p>PAR 4 (1-6) can be used for relevant research in the life sciences. Its product number is T36293 and CAS number is 225779-44-2.</p>Formula:C28H41N7O9Color and Shape:SolidMolecular weight:619.676BAY-747
CAS:<p>BAY-747: oral, brain-penetrant sGC stimulator; improves rat memory, cognition, lowers blood pressure, aids Duchenne muscular dystrophy.</p>Formula:C22H26F2N4O2Color and Shape:SolidMolecular weight:416.46EP4 receptor antagonist 3
CAS:<p>EP4 receptor antagonist 3 from patent WO2010019796 A1 targets EP4 for research on pain, arthritis, and cancer.</p>Formula:C26H21F3N2O3SColor and Shape:SolidMolecular weight:498.52LY 344864 racemate
CAS:<p>LY 344864 racemate is a 5-HT1F receptor agonist.</p>Formula:C21H22FN3OPurity:99.75%Color and Shape:SoildMolecular weight:351.42PACAP (1-27), human, ovine, rat
CAS:PACAP (1-27) (the N-terminal fragment of PACAP-38) is a novel neuropeptides originally isolated from bovine hypothalamus, also found in humans and rats.Formula:C142H224N40O39SPurity:98%Color and Shape:SolidMolecular weight:3147.66PF-232798
CAS:<p>PF-232798 is a second generation oral CCR5 antagonist with potent broad-spectrum anti-HIV-1 activity.</p>Formula:C29H40FN5O2Color and Shape:SolidMolecular weight:509.66PROTAC(H-PGDS)-8
CAS:<p>PROTAC(H-PGDS)-8 is a PROTAC degrader targeting Hematopoietic prostaglandin D synthase (H-PGDS), exhibiting an IC50 of 0.14 μM [1].</p>Formula:C41H40N8O7Color and Shape:SolidMolecular weight:756.81Tamuzimod
CAS:<p>Tamuzimod, an effective immunomodulator, exhibits modulatory activity on S1P Receptors with EC50 values below 1 μM [1] [2].</p>Formula:C21H13Cl3F3N5O3Color and Shape:SolidMolecular weight:546.71PAR-4 Agonist Peptide, amide
CAS:PAR-4 Agonist Peptide, amide (AY-NH2) is an agonist of proteinase-activated receptor-4 (PAR-4).Formula:C34H48N8O7Purity:98%Color and Shape:SolidMolecular weight:680.79Ro60-0175
CAS:<p>Ro60-0175 is a selective 5-HT2B and 5-HT2C serotonin receptor agonist, often used as fumarate.</p>Formula:C11H12ClFN2Purity:97.09%Color and Shape:SolidMolecular weight:226.68O-Desethyl Dapagliflozin
CAS:<p>O-Desethyl Dapagliflozin (Empagliflozin-4) is a SGLT2 inhibitor, IC50=33nM.</p>Formula:C19H21ClO6Purity:98.33%Color and Shape:SolidMolecular weight:380.82[Phe8Ψ(CH-NH)-Arg9]-Bradykinin
CAS:<p>Selective bradykinin B2 receptor agonist that is resistant to carboxypeptidase cleavage.</p>Formula:C50H75N15O10Purity:98%Color and Shape:SolidMolecular weight:1046.23Upacicalcet HCl
<p>Upacicalcet HCl, a calcium mimetic, reduces blood PTH by targeting parathyroid receptors; treats secondary hyperparathyroidism.</p>Formula:C11H15Cl2N3O6SPurity:98.56%Color and Shape:SoildMolecular weight:388.22SB-408124
CAS:SB408124: Non-peptide, OX1 receptor antagonist, Ki 57 nM (whole cell) and 27 nM (membrane), 50x more selective than OX2.Formula:C19H18F2N4OPurity:99.81%Color and Shape:SolidMolecular weight:356.379-deoxy-9-methylene Prostaglandin E2
CAS:<p>9-deoxy-9-methylene PGE2: stable PGE2 analog with similar effects, less side effects, equal potency in rats, gerbils, primates.</p>Formula:C21H34O4Color and Shape:SolidMolecular weight:350.499GLP-1R agonist 20
<p>GLP-1R agonist 20 (Compound I-132) is an agonist of the glucagon-like peptide-1 receptor (GLP-1 receptor), with an EC50 value of 0.0162 nM.</p>Formula:C31H30Cl2F2N4O5Molecular weight:646.15613Orexin B, rat, mouse
CAS:<p>Orexin B, rat, mouse is an endogenous agonist at Orexin receptor with Kis of 420 and 36 nM for OX1 and OX2, respectively.</p>Formula:C126H215N45O34SPurity:98%Color and Shape:SolidMolecular weight:2936.45[Sar9] Substance P
CAS:<p>[Sar9]-Substance P is one of NK-1 receptor agonist. The action of SP on progesterone metabolism was mimicked by the rNK1-specific agonist [Sar-9,Met(O2)11]-SP.</p>Formula:C64H100N18O13SPurity:98%Color and Shape:SolidMolecular weight:1361.66Bradykinin (1-6)
CAS:<p>Bradykinin (1-6) is a stable, CPY-cleaved metabolite that triggers pain, induces muscle contractions, and activates NO synthetase.</p>Formula:C30H45N9O8Purity:98%Color and Shape:SolidMolecular weight:659.73THX-B
CAS:<p>THX-B, a potent non-peptidic p75 NTR antagonist, aids in researching diabetic kidney disease and neurodegenerative and inflammatory disorders.</p>Formula:C16H24N6O4Color and Shape:SolidMolecular weight:364.4Substance P (1-9)
CAS:<p>Substance P (1-9), a nonapeptide, slows its own inactivation and stimulates neurons.</p>Formula:C52H77N15O12Purity:98%Color and Shape:SolidMolecular weight:1104.26Albiglutide fragment TFA
<p>Albiglutide fragment (GLP-1 (7-36) analog) TFA represents a biologically active segment of Albiglutide, resistant to DPP-4 degradation due to its structure as a</p>Formula:C148H224N40O45·xC2HF3O2Color and Shape:SolidLSN3160440
CAS:<p>LSN3160440 is a GLP-1R allosteric modulator and PPI stabilizer aiding inactive GLP-1 attachment.</p>Formula:C27H27Cl2N3OColor and Shape:SolidMolecular weight:480.43Detomidine carboxylic acid
CAS:<p>Detomidine carboxylic acid, a urine metabolite of detomidine, is a synthetic α2-agonist, animal analgesic, with cardiac, respiratory, and diuretic effects.</p>Formula:C12H12N2O2Purity:98%Color and Shape:SolidMolecular weight:216.24MRS2500 tetraammonium
CAS:<p>Highly potent and selective antagonist of the platelet P2Y1 receptor</p>Formula:C13H21IN6O8P2Purity:98%Color and Shape:SolidMolecular weight:578.19Bodilisant
CAS:<p>Bodilisant: nanomolar-affinity hH3R ligand, derived from piperidine, with BODIPY fluorophore.</p>Formula:C27H34BF2N3OColor and Shape:SolidMolecular weight:465.4Vicasinabin
CAS:<p>Vicasinabin: potent CB2 agonist; researches chronic pain, atherosclerosis, bone mass, neuroinflammation.</p>Formula:C15H22N10OColor and Shape:SolidMolecular weight:358.41Endolide F
Endolide F (Compound 2) is a proline-containing lactone that serves as a moderate antagonist of the arginine vasopressin V1A receptor.Formula:C25H32N4O6Molecular weight:484.23218GUB03385
<p>GUB03385 is a long-acting PrRP31 analogue and an effective dual agonist for GPR10 (full agonist, EC50: 0.4 nM) and NPFF2R (partial agonist, EC50: 20 nM), with anti-obesity properties.</p>Formula:C198H322N60O52SMolecular weight:4404.41173Cagrilintide acetate
<p>.Cagrilintide is a long-acting amylin analog,treat diabetes and obesity by reducing appetite through activation of the AMY3R and calcitonin receptor.</p>Formula:C196H316N54O61S2Purity:99.88%Color and Shape:SolidMolecular weight:4469.06Adenosine receptor antagonist 1
CAS:<p>A2aR-selective antagonist with IC50 of 0.29 nM; 14x more selective over A2bR.</p>Formula:C22H15ClFN7OColor and Shape:SolidMolecular weight:447.86Galanin (1-16), mouse, porcine, rat TFA
<p>Galanin (1-16) agonizes hippocampal receptors; Kd 3 nM. Active on locus coeruleus neurons in mice, pigs, rats.</p>Formula:C80H117F3N20O23Purity:98%Color and Shape:SolidMolecular weight:1783.915-keto Latanoprost
CAS:<p>Latanoprost, a PG analog for ocular pressure, metabolizes into 15-keto latanoprost, a less potent variant reducing intraocular pressure and pupil size.</p>Formula:C26H38O5Color and Shape:SolidMolecular weight:430.58Neuropeptide Y (13-36), amide, human
CAS:<p>Neuropeptide Y (13-36), amide, human is a neuropeptide Y receptor agonist.</p>Formula:C134H207N41O36SPurity:98%Color and Shape:SolidMolecular weight:3000.4γ-1-Melanocyte Stimulating Hormone (MSH), amide
<p>γ-1-Melanocyte Stimulating Hormone (MSH), amide, a peptide consisting of 11 amino acids, plays a critical role in regulating sodium (Na+) balance and blood</p>Formula:C72H97N21O14SColor and Shape:SolidMolecular weight:1512.9ARC 239 dihydrochloride
CAS:<p>ARC 239 dihydrochloride is a selective α2B adrenoceptor antagonist (pKD values are 8.8, 6.7 and 6.4 at α2B, α2A, and α2D receptors respectively).</p>Formula:C24H31Cl2N3O3Purity:99.72%Color and Shape:SolidMolecular weight:480.43S1R agonist 1
CAS:<p>Compound 6b: Selective S1R agonist, K i = 0.93 nM (S1R), 72 nM (S2R); neuroprotective against ROS, NMDA toxicity.</p>Formula:C20H25NOColor and Shape:SolidMolecular weight:295.42FXR/TGR5 agonist 1
CAS:<p>FXR/TGR5 agonist 1 acts as an agonist on both FXR and TGR5 receptors and is utilized for treating fatty liver disease.</p>Formula:C31H32ClN3O3Color and Shape:SolidMolecular weight:530.071-39-Corticotropin (human)(TFA)
ACTH (1-39) human (TFA) is a melanocortin agonist that boosts adrenal CS production and affects the CNS and immune system.Formula:C207H308N56O58S·C2HF3O2Purity:98%Color and Shape:SolidMolecular weight:4655.16Donetidine
CAS:<p>Donetidine is a histamine H2 receptor antagonist used to treat digestive disorders.</p>Formula:C20H25N5O3SPurity:99.32%Color and Shape:SolidMolecular weight:415.51Cortistatin 14, human, rat
CAS:<p>Cortistatin 14: a neuropeptide similar to somatostatin; induces sleep, depresses neuronal activity; found in cortex, hippocampus.</p>Formula:C81H113N19O19S2Purity:98%Color and Shape:SolidMolecular weight:1721.01BMS-604992 free base
CAS:<p>BMS-604992 (EX-1314), a selective GHSR agonist, binds strongly (ki=2.3 nM), is orally active, and increases rodent food intake.</p>Formula:C24H31N7O5Color and Shape:SolidMolecular weight:497.556Peptide C105Y TFA
Peptide C105Y TFA is a cell-penetrating peptide synthesized based on the amino acid sequence of residues 359-374 of α1-antitrypsin. It enhances the gene expression of DNA nanoparticles.Formula:C97H148N20O23S·xC2HF3O2Relaxin H3 (human) TFA
Relaxin H3 (human) (TFA) is a relaxin peptide that exerts antifibrotic effects through the RXFP1 receptor.Formula:C237H374N70O69S6·xC2HF3O2palm11-PrRP31
<p>Palm11-PrRP31 is a lipid-modified analog of the endogenous appetite-suppressing neuropeptide (PrRP). It functions as a potent dual agonist for GPR10 (EC50 = 39 pM) and NPFF-R2. By mimicking the natural activity of PrRP, palm11-PrRP31 binds to these receptors to reduce food intake. It has potential applications as an anti-obesity agent and is useful in studying neuropeptide and receptor interactions.</p>Formula:C181H289N55O46SMolecular weight:4001.1686513,14-dihydro Prostaglandin F2α
CAS:<p>13,14-dihydro Prostaglandin F2α (13,14-dihydro PGF2α) is the analog of PGF2α which has no unsaturation in the lower side chain.</p>Formula:C20H36O5Color and Shape:SolidMolecular weight:356.503A2A/A3 AR antagonist-1
<p>A2A/A3 AR antagonist-1 is a dual fluorescent AR ligand with K i of 90 nM (hA2A) & 31.8 nM (hA3).</p>Formula:C56H71N15O12S2Color and Shape:SolidMolecular weight:1210.39L-796,778 acetate
<p>L-796,778 acetate is a slective somatostatin receptor agonist with IC50 of 24nM for sst3, for sst1, sst2, sst4 and sst5, IC50 is >1000nM.</p>Formula:C31H44N6O9Purity:98%Color and Shape:SoildMolecular weight:644.72Satavaptan
CAS:<p>Satavaptan is a vasopressin V2 receptor antagonist. Satavaptan improves the control of ascites in cirrhosis.</p>Formula:C33H45N3O8SColor and Shape:SolidMolecular weight:643.79CB2R/FAAH modulator-3
CAS:<p>CB2R/FAAH modulator-3 (compound 27) is a modulator targeting at CB2R and FAAH.</p>Formula:C22H31NO2Purity:99.81%Color and Shape:SoildMolecular weight:341.49VVZ-149
<p>VVZ-149 is an antagonist of both serotonin receptor 2A (5HT2A) and glycine transporter type 2 (GlyT2), with potential anti-nociceptive activity.</p>Color and Shape:SolidGLP-1R/GIPR agonist-1
<p>GLP-1R/GIPR agonist-1 is a dual receptor agonist for GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulinotropic polypeptide). It mimics the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while suppressing glucagon release, thus lowering blood sugar. This compound is used in research related to metabolic disorders such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH).</p>Formula:C220H342N55O69Molecular weight:4858.49434α-Helical CRF(9-41)
CAS:<p>Corticotropin-releasing factor receptor antagonist (Ki values are 17, 5 and 0.97 at human CRF1, rat CRF2α and mouse CRF2β receptors respectively).</p>Formula:C166H274N46O53S2Purity:98%Color and Shape:SolidMolecular weight:382715(S)-HpEPE
CAS:<p>15(S)-HpEPE, a monohydroperoxy fatty acid, forms when 15-lipoxygenase acts on EPA, with expected biological activities akin to 15(S)-HpETE.</p>Formula:C20H30O4Color and Shape:SolidMolecular weight:334.456Oxyntomodulin
CAS:<p>GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.</p>Formula:C192H295N59O60SPurity:98%Color and Shape:SolidMolecular weight:4421.86PEN (rat)
CAS:<p>PEN (rat) is an Endogenous peptide GPR83 agonist. ProSAAS-derived neuropeptide.</p>Formula:C102H169N27O33Purity:98%Color and Shape:SolidMolecular weight:2301.62Cortistatin-14 acetate
<p>Cortistatin-14 acetate, a neuropeptide have structural similarity to somatostatin-14, binds and exerts its function via the somatostatin receptors (sst1-sst5).</p>Formula:C83H118N20O20S2Purity:98.24% - 99.63%Color and Shape:SoildMolecular weight:1780.08ethyl 1-[(4-cyanobenzyl)oxy]-2-(3-cyanophenyl)-4-methyl-1H-imidazole-5-carboxylate
CAS:<p>ethyl 1-[(4-cyanobenzyl)oxy]-2-(3-cyanophenyl)-4-methyl-1H-imidazole-5-carboxylate is a platelet aggregation inhibitor.</p>Formula:C22H18N4O3Purity:99.86%Color and Shape:SolidMolecular weight:386.4Metaterol
CAS:<p>Metaterol is a bioactive chemical.</p>Formula:C11H17NO2Color and Shape:SolidMolecular weight:195.258220-SOLA
<p>20-SOLA is the first water-soluble 20-HETE antagonist with oral bioavailability. It significantly improves blood pressure changes and kidney damage associated with the streptozotocin (STZ) diabetic mouse model. Additionally, 20-SOLA acts as a GPR75 receptor blocker. This compound is useful in research related to cardiovascular pathology.</p>Formula:C33H62O9Molecular weight:602.43938SC 31391
CAS:<p>SC 31391 is a PGE1 analog.</p>Formula:C24H32O6Color and Shape:SolidMolecular weight:416.51cAC 253 acetate
<p>cAC 253 acetate (TP2135 Free base) is an amylin antagonist. cAC 253 acetate inhibits 125I-adrenomedullin binding, with an IC50 of 25 nM.</p>Formula:C128H206N42O42S2Purity:98.16% - 99.99%Color and Shape:SoildMolecular weight:3069.39Tocrifluor T1117
CAS:<p>Fluorescent form of AM 251, CB1 receptor antagonist</p>Formula:C56H53Cl2N7O5Purity:98%Color and Shape:SolidMolecular weight:974.97L-770644
CAS:<p>L-770644 is an agonist of B3 adrenergic receptor.</p>Formula:C30H37N7O4SColor and Shape:SolidMolecular weight:591.72ACTH (1-17)
CAS:<p>ACTH (1-17), a potent MC1 receptor agonist with a Ki of 0.21 nM, is a variant of corticotropin from the pituitary gland.</p>Formula:C95H145N29O23SPurity:98%Color and Shape:SolidMolecular weight:2093.41GIP/GLP-1 dual receptor agonist-1
CAS:<p>Compound 4: GIP/GLP-1 agonist for metabolic/fatty liver disease research.</p>Color and Shape:SolidSomatostatin 1-28 acetate
<p>Somatostatin 1-28 acetate circulates in human plasma.</p>Purity:99.22%Color and Shape:SoildMAO-B-IN-3
<p>MAO-B-IN-3 is a reversible, selective inhibitor of monoamine oxidase B (MAO-B) with an IC50 of 96 nM and demonstrates affinity for the 5-HT6 receptor with a Ki</p>Formula:C24H25N3O2Purity:98%Color and Shape:SolidMolecular weight:387.47Pasireotide
CAS:Pasireotide (SOM 230) is a cyclohexapeptide, mimicking somatostatin with high affinity for sst1/2/3/4/5 receptors (pKi=8.2/9.0/9.1/<7.0/9.9).Formula:C58H66N10O9Purity:98%Color and Shape:SolidMolecular weight:1047.21MGV354
<p>MGV354 is a soluble activator of guanylate cyclase(sGC) with EC 50 s of <0.5 nM, and 5 nM in CHO and GTM-3 E cells, respectively [1] [2].</p>Formula:C35H37N5O3Purity:98%Color and Shape:SolidMolecular weight:575.7CYM5442 hydrochloride
CAS:<p>CYM 5442 HCl: potent, selective S1P1 agonist (EC50 = 1.35 nM), induces MAPK activation & lymphopenia, brain-penetrant.</p>Formula:C23H28ClN3O4Color and Shape:SolidMolecular weight:445.94BA 1
CAS:<p>Potent BB1, BB2, and BB3 agonist; IC50: 0.26, 1.55, 2.52 nM. Boosts glucose transport in myocytes, promotes cancer cell growth in vitro.</p>Formula:C57H76N14O11Purity:98%Color and Shape:SolidMolecular weight:1133.32PSMA/GRPR ligand 1
<p>PSMA/GRPR ligand 1 (compound 3) is a bispecific ligand with dual targeting capabilities for tumors that express PSMA(+) and GRPR(+).</p>Color and Shape:Odour Solid4-Butyl-α-agarofuran
CAS:<p>4-Butyl-alpha-agarofuran, a Gharu-wood derivative, is an anxiolytic, antidepressant, and aids neurological research.</p>Formula:C18H30OColor and Shape:SolidMolecular weight:262.43L-797,591 hydrochloride
L-797,591 HCl activates SSTR1, boosts p-ERK5 with AG1478, and enhances p38 phosphorylation, reversible by AG1478.Formula:C38H50ClN5O2Purity:98.65% - >99.99%Color and Shape:SoildMolecular weight:644.30Antibacterial agent 189
Antibacterialagent 189 (compound 3a) is a potent antibacterial agent with high binding affinity to the target proteins OMPA/exo-1,3-β-glucanase. It demonstrates effective antibacterial activity against Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Bacillus subtilis, Candida albicans, and Aspergillus flavus. Additionally, Antibacterialagent 189 exhibits strong binding affinity to the target proteins SMO and SUFU/GLI-1.Formula:C37H28N4OMolecular weight:544.22631Cetirizine Impurity C dihydrochloride
CAS:<p>Cetirizine Impurity C dihydrochloride is a Cetirizine metabolite and long-acting H1-antihistamine.</p>Formula:C21H27Cl3N2O3Color and Shape:SolidMolecular weight:461.81Galanin (1-29)(rat, mouse)
CAS:<p>Non-selective galanin agonist; Ki: GAL1-0.98, GAL2-1.48, GAL3-1.47 nM. Anticonvulsant, stops full seizures in rats.</p>Formula:C141H211N43O41Purity:98%Color and Shape:White Lyophilized PowderMolecular weight:3164.499[Pro34]Neuropeptide Y, porcine
CAS:[Pro34]Neuropeptide Y, porcine functions as a selective agonist for the NPY (Y1) receptor and induces vasoconstriction in the guinea pig's caval vein [1].Formula:C190H286N54O56Color and Shape:SolidMolecular weight:4222.63Cholic Acid 7-sulfate
CAS:<p>Cholic acid 7-sulfate: a cholic acid metabolite with added sulfate at position 7, increased in feces of male mice with specific diets.</p>Formula:C24H40O8SColor and Shape:SolidMolecular weight:488.64Antipsychotic agent-2
<p>Compound 11: potent antipsychotic, binds 5-HT1A/2A/2C, D2, H1 receptors; K is 56.6-1140 nM, BBB permeable.</p>Formula:C22H26FN5OColor and Shape:SolidMolecular weight:395.47FR252384
CAS:<p>FR252384 is an antagonist of the neuropeptide Y-Y5 receptor (IC50: 2.3 nM).</p>Formula:C18H17N3Purity:98%Color and Shape:SolidMolecular weight:275.35Xenopus orexin B
CAS:Xenopus orexin B, a neuropeptide identified as an endogenous ligand for an orphan G-protein-coupled receptor, acts as a potent agonist of OX2R [1].Formula:C130H219N45O40S2Color and Shape:SolidMolecular weight:3116.54ONO-8711
CAS:<p>ONO-8711 is a potent and selective competitive antagonist of EP1 receptor with Kis of 0.6 nM and 1.7 nM for human and mouse EP1, respectively.</p>Formula:C22H30ClNO4SColor and Shape:SolidMolecular weight:440Danshenol B
<p>Danshenol B is a natural product that can be used as a reference standard.</p>Formula:C22H26O4Color and Shape:SolidMolecular weight:354.446GLP-1R agonist 15
CAS:<p>GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .</p>Formula:C46H47FN8O7SColor and Shape:SolidMolecular weight:874.98GLP-1R agonist 29
<p>GLP-1R agonist 29 (Compound 20) is a GLP-1R agonist that induces hGLP-1R-mediated cAMP stimulation with an EC50 of 0.018 nM. It exhibits favorable pharmacokinetic properties and shows good in vivo exposure, with an AUC0-∞,sc of 77688 ng·h/mL.</p>Color and Shape:Odour SolidGLI1-IN-3
<p>GLI1-IN-3 (Compound 11a) is a triterpenoid-like compound that inhibits Hedgehog signaling in cancer cells with GLI1 overexpression. It suppresses the proliferation of non-small cell lung cancer and prostate cancer cell lines with excessive Hh signaling activation. Additionally, GLI1-IN-3 reduces the expression of GLI1 protein and its target genes associated with tumor progression and proliferation in A549 and DU-145 cancer cells.</p>Color and Shape:Odour SolidPentagastrin meglumine
CAS:<p>Pentagastrin meglumine is a synthetic pentapeptide that has effects like gastrin when given parenterally.</p>Formula:C44H66N8O14SColor and Shape:SolidMolecular weight:963.11Urocortin II, human TFA
<p>hUcn II, a CRF family member, targets CRF2 receptor, has time-linked stress regulation effects, showing mild motor suppression and delayed anxiolytic action.</p>Formula:C196H340F3N63O56SPurity:98%Color and Shape:SolidMolecular weight:4564.3α-Bulnesene
CAS:α-Bulnesene, a novel PAF (platelet-activating factor) receptor antagonist, exhibits an IC50 of 17.62 μM. It can be isolated from patchouli. α-Bulnesene inhibits both PAF and arachidonic acid-induced aggregation of rabbit platelets.Formula:C15H24Color and Shape:SolidMolecular weight:204.35Roxatidine
CAS:<p>Roxatidine, a metabolite of Roxatidine acetate, is a H2-receptor antagonist that prevents ulcers and has anti-inflammatory properties.</p>Formula:C17H26N2O3Color and Shape:SolidMolecular weight:306.4Cetirizine methyl ester
CAS:<p>Cetirizine methyl ester is a Cetirizine impurity, a long-acting, oral H1-antihistamine and hydroxyzine metabolite.</p>Formula:C22H27ClN2O3Color and Shape:SolidMolecular weight:402.91PAR 4 (1-6) (TFA)
PAR 4 (1-6) TFA (GYPGQV TFA), a hexapeptide derived from protease-activated receptor 4 (PAR 4), serves as a specific agonist for PAR 4.Formula:C28H41N7O9·xC2HF3O2Color and Shape:SolidRWJ 676070
CAS:<p>RWJ 676070 is an antagonist of vasopressin V1A/V2 receptor.</p>Formula:C30H26ClFN2O5Color and Shape:SolidMolecular weight:548.99Ontazolast
CAS:<p>Ontazolast: a small-molecule LTB4R antagonist targeting asthma and immune disorders.</p>Formula:C21H25N3OPurity:99.79%Color and Shape:SoildMolecular weight:335.44FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Color and Shape:SolidMolecular weight:3692.15P4pal10 TFA
<p>P4pal10 TFA, the TFA salt form of P4pal10, serves as an antagonist of the protease-activated receptor 4 (PAR4). This compound inhibits platelet aggregation and thrombin generation induced by tissue factor (TF), exhibiting anticoagulant and antithrombotic activities. Additionally, P4pal10 TFA alleviates carrageenan-induced edema and neutrophil infiltration, and ameliorates damage in rat myocardial ischemia/reperfusion (I/R) models.</p>Color and Shape:Odour SolidTGR5 agonist 2
<p>TGR5 agonist 2 (compound 19) serves as a highly potent agonist of TGR5, demonstrating an EC50 value of 0.27 µM [1].</p>Formula:C29H50NNaO6SColor and Shape:SolidMolecular weight:563.77HAEGT
CAS:<p>HAEGT is the first N-terminal 1-5 residues of GLP-1 peptide.</p>Formula:C20H31N7O9Purity:98%Color and Shape:SolidMolecular weight:513.5Clomipramine D3
CAS:<p>Clomipramine D3 is deuterium-labeled Clomipramine, blocking serotonin, norepinephrine, dopamine transporters (Ki: 0.14, 54, 3 nM).</p>Formula:C19H23ClN2Purity:98%Color and Shape:SolidMolecular weight:317.87α1A-AR Degrader 9c
CAS:<p>α1A-AR Degrader 9c is a potent, selective, and reversible PROTAC degrader targeting the α1A adrenergic receptor (α1A-AR) with a DC50 of 2.86 μM.</p>Formula:C38H43N11O11Purity:98%Color and Shape:SolidMolecular weight:829.82Cetirizine Impurity D
CAS:<p>Cetirizine Impurity D, an antihistamine derivative, acts as a long-lasting H1-receptor antagonist with antiallergic effects.</p>Formula:C30H28Cl2N2Color and Shape:SolidMolecular weight:487.4613,14-dihydro-15-keto Prostaglandin F1α
CAS:<p>13,14-dihydro-15-keto Prostaglandin F1α (13,14-dihydro-15-keto PGF1α) is a metabolite of PGF1α that has been reported in the rat stomach.</p>Formula:C20H36O5Color and Shape:SolidMolecular weight:356.5CB2R probe 1
CAS:<p>CB2R Probe 1, a cannabinoid 2 receptor (CB2R) fluorescent probe, exhibits both safety and environmental friendliness, boasting a dissociation constant (K i) of</p>Formula:C36H42N4O4Color and Shape:SolidMolecular weight:594.74Benzomalvin B
CAS:<p>Benzomalvin B, a metabolite from Penicillium, blocks 24% NK1 receptor binding at 100 μg/ml.</p>Formula:C24H17N3O2Color and Shape:SolidMolecular weight:379.419LAS190792
CAS:<p>LAS190792 (AZD8999) is a dual muscarinic antagonist/β2-agonist, pIC50s (M1-M5, β1-β3): 8.9-5.6; used as a bronchodilator.</p>Formula:C39H43ClN4O9S2Color and Shape:SolidMolecular weight:811.36MrgprX2 antagonist-5
CAS:<p>MrgprX2 antagonist-5 from patent WO2020223255A1 inhibits MrgprX2, useful for inflammatory skin disorder studies.</p>Formula:C19H13ClF2N4O2SColor and Shape:SolidMolecular weight:434.85Septide
CAS:<p>Septide is an NK1 receptor agonist acting at a site distinct from substance P.</p>Formula:C39H53N7O7SPurity:98%Color and Shape:SolidMolecular weight:763.95SR 142948 dihydrochloride
<p>SR 142948 dihydrochloride is a selective oral non-peptide NT antagonist, IC50 <4 nM, with brain penetration and potential for psychiatric research.</p>Formula:C39H53Cl2N5O6Color and Shape:SolidMolecular weight:758.77Prolactin Releasing Peptide (1-31), human
CAS:<p>Human Prolactin Releasing Peptide (1-31) is a potent GPR10 agonist; Ki values are 1.03 nM (human) and 0.33 nM (rat).</p>Formula:C160H252N56O42SPurity:98%Color and Shape:SolidMolecular weight:3664.15Tafluprost acid
CAS:<p>Tafluprost acid is a selective agonist at the prostaglandin F receptor.</p>Formula:C22H28F2O5Color and Shape:SolidMolecular weight:410.46GI-560192
CAS:<p>GI-560192 (RL-0070933), a potent smo modulator, EC50: 0.02µM; affects smoothened in cilia via hedgehog signaling.</p>Formula:C20H16N2O2Purity:99.53%Color and Shape:SoildMolecular weight:316.35Spantide acetate
<p>Spantide acetate is a selective antagonist of NK1 receptor with Kis of 230 nM and 8150 nM for NK1 and NK2.</p>Formula:C77H112N20O15Purity:98.9200%Color and Shape:SolidMolecular weight:1557.84BQ-123 TFA
<p>BQ-123 TFA: Potent ETA antagonist, IC50 = 7.3 nM, Ki = 25 nM, inhibits ET-1 cell proliferation, lowers rat BP.</p>Formula:C33H43F3N6O9Color and Shape:SolidMolecular weight:724.72DSP-1053
CAS:<p>Dsp-1053 is a powerful SERT (Ki=1.02 nM) inhibitor with partial 5-HT1A receptor (Ki=5.05 nM) agonizing activity.</p>Formula:C26H32BrNO4Purity:98%Color and Shape:SolidMolecular weight:502.44PSB 0777 ammonium salt
CAS:<p>adenosine A2A receptor full agonist</p>Formula:C18H24N6O7S2Purity:98%Color and Shape:SolidMolecular weight:500.555-HT7R antagonist 1 free base
CAS:<p>5-HT7R antagonist 1 (free base) is a G protein-biased antagonist for the 5-HT 7 R receptor, with a dissociation constant (K i) of 6.5 nM.</p>Formula:C14H17ClN4Color and Shape:SolidMolecular weight:276.77Brexpiprazole S-oxide D8
CAS:<p>Brexpiprazole S-oxide D8 (DM-3411 D8) is a deuterium-labeled metabolite of Brexpiprazole, a partial agonist at 5-HT1A and dopamine receptors.</p>Formula:C25H19D8N3O3SPurity:98%Color and Shape:SolidMolecular weight:457.61PHM-27 (human)
CAS:<p>Human-derived peptide, VIP/PHM 27 analog, boosts insulin by targeting calcitonin receptor with an EC50 of 11 nM.</p>Formula:C135H214N34O40SPurity:98%Color and Shape:SolidMolecular weight:2985.44Hemopressin (human, mouse)
CAS:<p>Endogenous peptide, inhibits ep24.15/24.16/ACE with Ki of 27.76/3.43/1.87 μM. Lowers blood pressure, CB1 inverse agonist, reduces pain in vivo.</p>Formula:C50H79N13O12Purity:98%Color and Shape:SolidMolecular weight:1054.26(S)-V-0219 hydrochloride
<p>(S)-V-0219 hydrochloride, a GLP-1R PAM, triggers calcium in hGLP-1R HEK cells, lowers glucose in mice, and reduces fasting hunger.</p>Formula:C20H26ClF3N4O2Color and Shape:SolidMolecular weight:446.89Lys-[Des-Arg9]Bradykinin
CAS:Selective bradykinin B1 agonist with Ki 0.12 nM; inactive at B2 (>30,000 nM). Lowers blood pressure, more potent than Des-Arg9-Bradykinin.Formula:C50H73N13O11Purity:98%Color and Shape:SolidMolecular weight:1032.21Isobutyryl-L-carnitine
CAS:<p>Isobutyryl-L-carnitine is a member of the class of compounds known as acylcarnitines. Isobutyryl-L-carnitine is a product of the acyl-CoA dehydrogenases.</p>Formula:C11H21NO4Purity:98%Color and Shape:SolidMolecular weight:231.29GLP-1 (9-36) amide
CAS:<p>GLP-1 (9-36) amide is an antagonist at the human GLP-1 receptor.</p>Formula:C140H214N36O43Purity:97%Color and Shape:SolidMolecular weight:3089.41GLP-1(7-37)
CAS:<p>GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells.</p>Formula:C151H228N40O47Purity:98%Color and Shape:SolidMolecular weight:3355.67YM 09538
CAS:<p>YM 09538 is a biochemical.</p>Formula:C18H25ClN2O5SColor and Shape:SolidMolecular weight:416.92Dolcanatide
CAS:Dolcanatide: oral GC-C agonist with laxative, pain-relief, and anti-inflammatory properties for IBD research.Formula:C65H104N18O26S4Color and Shape:SolidMolecular weight:1681.89PACAP-Related Peptide (PRP), human
<p>PRP, human: 29-amino-acid PACAP precursor segment, synthesized for biological/structural research.</p>Formula:C139H229N41O42Purity:98%Color and Shape:SolidMolecular weight:3146.57Glucagon-like peptide 1 (1-37), human TFA
<p>Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.</p>Formula:C188H276N51F3O61Purity:98%Color and Shape:SolidMolecular weight:4283.5Neuromedin N
CAS:<p>Neuromedin N is a neuropeptide derived from the same precursor polypeptide as neurotensin, and with similar but subtly distinct expression and effects.</p>Formula:C38H63N7O8Purity:98%Color and Shape:SolidMolecular weight:745.95Levocarnitine propionate hydrochloride
CAS:<p>Levocarnitine propionate hydrochloride (ST-261) is used for the treatment of the deterioration of renal function, congestive heart failure, and other diseases.</p>Formula:C10H20ClNO4Purity:90% - 99.77%Color and Shape:SolidMolecular weight:253.72PD 142893
CAS:<p>PD 142893 is a functional endothelin-stimulated vasoconstriction antagonist.</p>Formula:C50H65N7O10Purity:98%Color and Shape:SolidMolecular weight:924.09Hemopressin(rat)
CAS:<p>Peptide inhibitor for ep24.15, neurolysin & ACE with Ki 27.76, 3.43, 1.87 μM. Lowers blood pressure, modulates CB1 receptor, reduces pain & food intake.</p>Formula:C53H77N13O12Purity:98%Color and Shape:SolidMolecular weight:1088.27Antidepressant agent 4
<p>Antidepressant agent 4: orally active, has antidepressant, anxiolytic, and nootropic effects.</p>Formula:C19H38ClN5O2SColor and Shape:SolidMolecular weight:436.06GPR183 antagonist-3
<p>GPR183 antagonist-3 (compound 33) is an orally active GPR183 antagonist with an IC50 value of 8.7 μM. It demonstrates significant in vitro anti-migration and anti-inflammatory activity in monocytes and can alleviate pathological symptoms in experimental colitis induced by dextran sulfate sodium.</p>Formula:C21H19BrN4O2SMolecular weight:470.04121Donitriptan hydrochloride
CAS:<p>Donitriptan hydrochloride (Donitriptan monohydrochloride) is a potent, high efficacy agonist of 5-HT1B/1D receptors with pKis of 9.4 and 9.3, respectively</p>Formula:C23H26ClN5O2Purity:99.8% - 99.86%Color and Shape:SolidMolecular weight:439.94Guanylin TFA (mouse,rat)
<p>Guanylin (mouse, rat) TFA is a peptide composed of 15 amino acids and acts as an activator of intestinal guanylate cyclase. This compound is utilized in research related to diarrhea.</p>Formula:C60H90N16O22S4·xC2HF3O2Color and Shape:SolidMolecular weight:1515.71 (free base)PACAP (6-38), human, ovine, rat TFA
<p>PACAP (6-38) is a PACAP receptor blocker with IC50s of 30, 600, 40 nM for type I, VIP1, and VIP2 receptors.</p>Formula:C184H301N56FO47SPurity:98%Color and Shape:SolidMolecular weight:4138.76Amitraz
CAS:<p>Amitraz (NSC 324552): white monoclinic crystals, mp 86-87°C, water-insoluble, used as acaricide and in canine demodectic mange.</p>Formula:C19H23N3Purity:99.88%Color and Shape:White/Pale Yellow Crystalline SolidMolecular weight:293.41Mosapride citrate dihydrate
CAS:<p>Mosapride Citrate, a 5-HT4 agonist, boosts gut movement by enhancing acetylcholine release.</p>Formula:C27H35ClFN3O11Purity:98%Color and Shape:SolidMolecular weight:632.04KwFwLL-NH2
CAS:<p>KwFwLL-NH2 is a hexapeptide that serves as a ligand for the ghrelin receptor (ghrelin receptor). This compound acts as a specific inverse agonist for the ghrelin receptor, exhibiting moderate potency (EC50=45.6 nM).</p>Formula:C49H66N10O6Color and Shape:SolidMolecular weight:891.11Adrenomedullin (1-50), rat
CAS:Rat adrenomedullin (1-50) is a 50-AA peptide; induces arterial vasodilation by activating CGRP1 receptors.Formula:C248H381N77O75S5Purity:98%Color and Shape:SolidMolecular weight:5729.5β-CGRP (mouse)
<p>β-CGRP (mouse), a calcitonin gene-related peptide, induces vasodilation and is applicable in research areas including cardiovascular, pro-inflammatory, migraine, and metabolic studies.</p>Formula:C165H265N49O55S2Color and Shape:SolidMolecular weight:3879.29SGLT1/2-IN-2
CAS:<p>SGLT1/2-IN-2 is a chemical compound with robust dual inhibitory properties, exhibiting potent activities against SGLT1 (IC50 = 96 nM) and SGLT2 (IC50 = 1.3 nM).</p>Formula:C23H26F2O7Color and Shape:SolidMolecular weight:452.451Adenosine receptor agonist 1
<p>Compound 6m, an A3 adenosine receptor (AR) partial agonist, exhibits a K i value of 6.7 nM as an adenosine receptor agonist.</p>Formula:C12H14ClN5O2SeColor and Shape:SolidMolecular weight:374.68Y1 receptor antagonist 1 formic
<p>H 409-22 isomer formic, a formate salt of Y1 receptor antagonist 1, is an antagonist of the neuropeptide Y1 receptor (neuropeptide Y1 receptor). This compound effectively blocks the actions of the receptor, playing a crucial role in modulating physiological responses.</p>Formula:C29H35N5O5Color and Shape:SolidMolecular weight:533.62NSC380324
<p>NSC380324 is a P2Y12 receptor antagonist with antiplatelet properties, which can be employed in research on atherosclerotic cardiovascular diseases.</p>Formula:C31H24N4O4Color and Shape:SolidMolecular weight:516.55Neuropeptide Y (22-36)
CAS:<p>Neuropeptide Y (22-36) is a 15-amino acid fragment of NPY, which is abundant in the mammalian brain and involved in multiple physiological functions.</p>Formula:C85H139N29O21Purity:98%Color and Shape:SolidMolecular weight:1903.19Motilin, canine
CAS:<p>Motilin canine, a 22-amino acid peptide, functions as a robust gastrointestinal smooth muscle contraction agonist.</p>Formula:C120H194N36O34Purity:98%Color and Shape:SolidMolecular weight:2685.05[18F]-Labeled L-dopa precursor
CAS:<p>[18F]-Labeled L-dopa precursor is a precursor for synthesis of 18F-labeled L-dopa[1].</p>Formula:C35H36N2O7Color and Shape:SolidMolecular weight:596.67des-Gln14-Ghrelin
CAS:<p>Endogenous rat ghrelin gene variant binds GHS-R1a; strong Ca2+ release (EC50=2.4 nM); boosts GH secretion in vivo.</p>Formula:C142H237N43O40Purity:98%Color and Shape:SolidMolecular weight:3186.72-Furoyl-LIGRLO-amide
CAS:<p>2-Furoyl-LIGRLO-amide TFA is a peptide that acts as a proteinase-activated receptor-2 (PAR2) agonist, and contains a furoyl group addition at its N-terminal.</p>Formula:C36H63N11O8Purity:98%Color and Shape:SolidMolecular weight:777.95Senktide TFA
<p>Senktide TFA is a potent and selective neurokinin 3 (NK3) receptor agonist with an EC50 of 0.5-3 nM, while showing significantly weaker activity on NK1 receptors (EC50=35 µM). It is a promising candidate for research in neurological disorders.</p>Color and Shape:Odour SolidBamosiran
CAS:<p>Bamosiran, a small interfering RNA (siRNA), specifically targets the β-adrenergic receptor 2 to reduce intraocular pressure.</p>Color and Shape:Solid(R)-Preclamol hydrochloride
CAS:<p>(R)-Preclamol HCl is a dopamine agonist stimulating both auto and postsynaptic receptors.</p>Formula:C14H22ClNOColor and Shape:SolidMolecular weight:255.78Alosetron-d3
CAS:<p>Alosetron D3 (GR 68755 D3) is a deuterium-labeled Alosetron. Alosetron is an antagonist of 5HT3-receptor.</p>Formula:C17H18N4OPurity:98%Color and Shape:SolidMolecular weight:297.37Neuropeptide Y(29-64)
CAS:<p>Neuropeptide Y(29-64) is a 36 amino acid peptide, a fragment of Neuropeptide Y.</p>Formula:C189H284N54O58SPurity:98%Color and Shape:SolidMolecular weight:4272.7Phoenixin-14 TFA
<p>Phoenixin-14 TFA (PNX-14 TFA) is an endogenous neuropeptide that can modulate GnRH receptor expression and exerts anxiolytic effects.</p>Formula:C75H110N18O20·xC2HF3O2Purity:99.11%Color and Shape:SolidMolecular weight:1583.78 (free base)Thioperamide maleate
CAS:<p>Thioperamide maleate (MR-12842 maleate) is an effective and selective antagonist of H3 receptor (Ki = 4.3 nM) for inhibition of [3H]histamine synthesis (Ki = 31</p>Formula:C19H28N4O4SPurity:98.48%Color and Shape:SolidMolecular weight:408.5219(R)-hydroxy Prostaglandin E1
CAS:<p>19(R)-hydroxy Prostaglandin E1 is an agonist of EP1 and EP3 receptor subtypes and exhibits contractile activity on smooth muscle and is the major prostaglandin</p>Formula:C20H34O6Color and Shape:SolidMolecular weight:370.486Semaglutide TFA
<p>Semaglutide TFA is a glucagon-like peptide-1 congener that induces weight loss, lowers blood glucose levels and reduces cardiovascular risk in diabetic patients</p>Formula:C189H290F3N45O61Purity:99.69%Color and Shape:SolidMolecular weight:4225.6482GLP-1(7-36), amide acetate
CAS:<p>GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide , activate the GLP-1 receptor, promote insulin secretion,Type 2 diabetes mellitus and obesity.</p>Formula:C151H230N40O47Purity:99.89%Color and Shape:SolidMolecular weight:3357.68SR142948A
CAS:<p>SR142948A is a selective and reversible non-peptide neurotensin receptor antagonist blocking hypothermia and analgesic effects, NMDA-induced dopamine release.</p>Formula:C39H52ClN5O6Purity:98%Color and Shape:SolidMolecular weight:722.31Eloralintide sodium
<p>Eloralintide sodium (LY-3841136 sodium) is an AMYR (amylin receptor) agonist applicable for studying type 2 diabetes and obesity.</p>Formula:C201H319N49O65S2·xNaPurity:98.66%Color and Shape:SolidMolecular weight:4526.1 (free base)S1PR1 modulator 1
CAS:<p>S1PR1 modulator 1 is a selective inhibitor of S1PR1 with a pIC50 of 7.6.</p>Formula:C23H24N2O3SPurity:99.69%Color and Shape:SolidMolecular weight:408.51Pexopiprant
CAS:<p>Pexopiprant, a potent oral antagonist of the prostaglandin D2 receptor 2 (DP2) with a K i value less than 100nM, is a valuable compound for asthma research.</p>Formula:C21H17Cl2F2NO4Color and Shape:SolidMolecular weight:456.27RFRP-3(human)
CAS:<p>NPFF1 receptor agonist, IC50 0.7 nM, blocks cAMP by forskolin. A GnIH homolog, it inhibits GnRH neuron activity.</p>Formula:C45H72N14O10Purity:98%Color and Shape:SolidMolecular weight:969.15MM 07
CAS:<p>Biased agonist for apelin/G protein pathway, enhances eNOS and cell growth, reduces apoptosis, improves heart function, and dilates vessels.</p>Formula:C67H106N22O14S3Purity:98%Color and Shape:SolidMolecular weight:1539.9Setmelanotide Acetate(920014-72-8 free base)
CAS:<p>Setmelanotide Acetate(920014-72-8 free base) (RM-493 Acetate) is a selective agonist of melanocortin 4 receptor (MC4R)(human and rat MC4R with EC50s of 0.27 nM</p>Formula:C51H72N18O11S2Purity:99.71%Color and Shape:SolidMolecular weight:1177.35(S)-Osanetant
CAS:<p>(S)-Osanetant, an S-enantiomer, is a selective NK3 antagonist with potential for treating schizophrenia and has anxiolytic and antidepressant effects.</p>Formula:C35H41Cl2N3O2Color and Shape:SolidMolecular weight:606.62tetranor-PGJM
CAS:<p>Tetranor-PGJM is a metabolite of prostaglandin D2 and is associated with the anti-inflammatory effects of curcumin.</p>Formula:C16H22O6Color and Shape:SolidMolecular weight:310.346Antibiotic Sch 60057
CAS:<p>Antibiotic Sch 60057 is a useful organic compound for research related to life sciences. The catalog number is T125403 and the CAS number is 203061-35-2.</p>Formula:C45H84O6Color and Shape:SolidMolecular weight:721.161[Des-His1,Glu9]-Glucagon amide
CAS:<p>Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.</p>Formula:C148H221N41O47SPurity:98%Color and Shape:SolidMolecular weight:3358.685-HT1AR/5-HT6R ligand-1
<p>5-HT1AR/5-HT6R ligand-1 (Compound PP13) functions as a ligand for the 5-HT receptor, demonstrating high affinity for 5-HT1AR, 5-HT6R, and 5-HT7R with Ki values of 19, 69, and 198 nM, respectively. In HEK293 cells, it inhibits cAMP production with EC50 values of 1535, 488, and 53 nM for these receptors. Additionally, 5-HT1AR/5-HT6R ligand-1 exhibits antiproliferative effects on several cancer cell lines, including 1321N1, U87MG, MCF7, and AsPC-1, with IC50 values of 9.6, 13.6, 19.3, and 14.6 μM, respectively. The compound also shows antagonistic activity towards the dopamine receptor D2R, with a Ki of 1903 nM.</p>Formula:C25H29ClN4O2SColor and Shape:SolidMolecular weight:485.04Mini Gastrin I, human
CAS:<p>Mini Gastrin I, human, is a truncated form of the human gastrin peptide, encompassing amino acids 5-17 of the original sequence.</p>Formula:C74H99N15O26SPurity:98%Color and Shape:SolidMolecular weight:1646.73Sarafotoxin S6b
CAS:<p>non-selective endothelin receptor agonist</p>Formula:C110H163N27O34S5Purity:98%Color and Shape:SolidMolecular weight:2567.96MDL 29913
CAS:NK2 tachykinin receptor selective antagonist.Formula:C40H56N8O6Purity:98%Color and Shape:SolidMolecular weight:745Conessine hydrobromide
CAS:<p>Conessine hydrobromide is a naturally occurring steroid alkaloid and has been used in traditional herbal medicine as a treatment for amoebic dysentery.</p>Formula:C24H41BrN2Color and Shape:SolidMolecular weight:437.51Spantide I
CAS:<p>Spantide antagonizes both bombesin & substance P. It is also tachykinin receptor antagonist.</p>Formula:C75H108N20O13Purity:98%Color and Shape:SolidMolecular weight:1497.79Bim 21009
CAS:Bim 21009 is an inhibitor of gonadorelin.Formula:C74H92ClN17O13Purity:98%Color and Shape:SolidMolecular weight:1463.08TRAP-6 amide
CAS:TRAP-6 amide is a PAR-1 thrombin receptor agonist peptide.Formula:C34H57N11O8Color and Shape:SolidMolecular weight:747.899

