GPCR/G-Protein
GPCR/G-Protein inhibitors are compounds that target G-protein coupled receptors (GPCRs) and associated G-proteins, which play critical roles in transmitting signals from the outside to the inside of cells. These inhibitors are essential for studying the signaling pathways mediated by GPCRs, which are involved in numerous physiological processes, including sensory perception, immune response, and neurotransmission. GPCR inhibitors are also important in drug development, as many therapeutic agents target these receptors. At CymitQuimica, we offer a wide range of high-quality GPCR/G-Protein inhibitors to support your research in pharmacology, cell biology, and related fields.
Subcategories of "GPCR/G-Protein"
- 5-HT Receptor(1,024 products)
- Adenosine Receptor(249 products)
- Adrenergic Receptor(3,029 products)
- Bombesin Receptor(35 products)
- Bradykinin Receptor(61 products)
- CXCR(159 products)
- CaSR(34 products)
- Cannabinoid Receptor(217 products)
- Cholecystokinin(1 products)
- Dopamine Receptor(443 products)
- Endothelin Receptor(86 products)
- GNRH Receptor(83 products)
- GPCR19(33 products)
- GRK(33 products)
- GTPase(22 products)
- Glucagon Receptor(195 products)
- Hedgehog/Smoothened(49 products)
- Histamine Receptor(385 products)
- LPA Receptor(21 products)
- Melatonin Receptor(26 products)
- OX Receptor(42 products)
- Opioid Receptor(326 products)
- PAFR(14 products)
- PKA(52 products)
- S1P Receptor(17 products)
- SGLT(31 products)
- Sigma receptor(46 products)
Show 19 more subcategories
Found 5972 products of "GPCR/G-Protein"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Calcitonin (8-32), salmon
CAS:Calcitonin (8-32), salmon: selective amylin receptor antagonist, regulates calcium/phosphorus, thyroid origin, 32-aa peptide.Formula:C119H198N36O37Purity:98%Color and Shape:SolidMolecular weight:2725.06Anthramycin
CAS:Anthramycin: a PBD family antibiotic with antitumor effects and CNS cholecystokinin antagonist properties in mice.Formula:C16H17N3O4Color and Shape:SolidMolecular weight:315.32Mapenterol hydrochloride
CAS:Mapenterol hydrochloride is an agonist of β2-adrenergic receptor.Formula:C14H21Cl2F3N2OPurity:98.11% - 99.98%Color and Shape:SolidMolecular weight:361.23Ref: TM-T40622
1mg52.00€5mg107.00€10mg158.00€25mg263.00€50mg378.00€100mg548.00€500mg1,093.00€1mL*10mM (DMSO)113.00€{Val1}-Exendin-3/4
{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.Formula:NAPurity:98%Color and Shape:SolidMolecular weight:3241.7QWF
CAS:Tripeptide SP antagonist (IC50: 90 μM); blocks SP-MRGPR X2 binding and mast cell degranulation; reduces 48/80-induced scratching in mice.Formula:C38H43N5O8Purity:98%Color and Shape:SolidMolecular weight:697.78PF-9184
CAS:PF-9184 inhibits human mPGES-1 selectively, with an IC50 of 16.5 nM, and reduces IL-1β-stimulated PGE2 production in vitro.Formula:C21H14Cl2N2O4SPurity:97.43%Color and Shape:SolidMolecular weight:461.32BNP (1-21), Pro (Human)
CAS:BNP (1-21), Pro (Human) is a 21-amino acid peptide and a form of B-Type Natriuretic Peptide (BNP), a cardiac natriuretic hormone.Formula:C89H144N28O35Molecular weight:2166.26[Ala17]-MCH acetate
[Ala17]-MCH acetate is a selective ligand for MCHR1 with a Ki of 0.16 nM and Kd of 0.37 nM(Eu3+ chelate-labeled).Formula:C99H159N29O28S4Purity:98.92%Color and Shape:SolidMolecular weight:2331.76GLP-1R agonist 26
CAS:Compound 1, also known as GLP-1R agonist 26, is an agonist of the glucagon-like peptide-1 receptor (GLP-1R) with an EC50 of <10 nM.Formula:C32H29FN6O4SMolecular weight:612.67AGN 191976
CAS:AGN 191976 is a novel thromboxane A2-mimetic.Formula:C21H32O6Color and Shape:SolidMolecular weight:380.481P4pal10 TFA
P4pal10 TFA, the TFA salt form of P4pal10, serves as an antagonist of the protease-activated receptor 4 (PAR4). This compound inhibits platelet aggregation and thrombin generation induced by tissue factor (TF), exhibiting anticoagulant and antithrombotic activities. Additionally, P4pal10 TFA alleviates carrageenan-induced edema and neutrophil infiltration, and ameliorates damage in rat myocardial ischemia/reperfusion (I/R) models.Color and Shape:Odour SolidHuman growth hormone-releasing factor
CAS:GHRH from the hypothalamus prompts the pituitary to produce/release GH by attaching to the GHRHR.Formula:C215H358N72O66SPurity:98%Color and Shape:SolidMolecular weight:5039.65FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Color and Shape:SolidMolecular weight:3692.15YFLLRNP
CAS:YFLLRNP is a biologically active peptide functioning as a partial agonist of PAR-1, selectively activating the G12/13 signaling pathway.Formula:C45H67N11O10Color and Shape:SolidMolecular weight:922.08Semaglutide, FITC labeled
Semaglutide (FITC-labeled Semaglutide) is a long-acting analog of human glucagon-like peptide-1, functioning as an agonist of the GLP-1 receptor. It shows potential for research related to type 2 diabetes.Formula:C209H304N46O63SMolecular weight:4498.171911,8-Cineole
CAS:Eucalyptol, a natural monoterpenoid and cyclic ether found in eucalyptus species, effectively controls excessive airway mucus secretion and asthma by inhibiting pro-inflammatory cytokines. It serves as an efficacious treatment for non-purulent sinusitis, reducing inflammation and pain when applied topically, and demonstrating leukemic cell-killing capabilities in vitro.Formula:C10H18OPurity:97.44% - 97.44%Color and Shape:SolidMolecular weight:154.25Suntinorexton
CAS:Suntinorexton (TAK 861) is an orexin type 2 receptor (OX2R) agonist used in the study of neurologic disorders.Formula:C23H28F2N2O4SPurity:99.89%Color and Shape:SolidMolecular weight:466.54Ref: TM-T39807
1mg174.00€5mg440.00€10mg704.00€25mg1,074.00€50mg1,448.00€100mg1,892.00€200mg2,539.00€1mL*10mM (DMSO)452.00€(D-Trp6)-LHRH free acid
CAS:(D-Trp6)-LHRH free acid is a luteinizing hormone-releasing hormone ( LHRH ) agonist [1] .Formula:C64H81N17O14Molecular weight:1312.43Adatanserin hydrochloride
CAS:Adatanserin hydrochloride (WY50324 hydrochloride) is a 5-HT(1A)/5-HT(2) receptor ligand that is neuroprotective and may be used in the study of depression.Formula:C21H32ClN5OPurity:99.64%Color and Shape:SolidMolecular weight:405.96ACTH (34-39)
CAS:ACTH (34-39) is an adrenocorticotropic hormone fragment.Formula:C37H50N6O9Purity:98%Color and Shape:SolidMolecular weight:722.83[Des-Arg10]-HOE I40 TFA
<p>[Des-Arg10]-HOE I40 TFA is a potent antagonist of the bradykinin B1 receptor.</p>Formula:C53H77N15O12S·xC2HF3O2Color and Shape:SolidA 70874
CAS:A70874 has high selectivity and potency for cholecystokinin (CCK) a receptor.Formula:C45H55N7O10Color and Shape:SolidMolecular weight:853.974Prostaglandin E2 isopropyl ester
CAS:PGE2 isopropyl ester, a lipophilic prodrug of PGE2, gains solubility in lipids and activates upon in vivo hydrolysis.Formula:C23H38O5Color and Shape:SolidMolecular weight:394.552Pal-Glu(OSu)-OH
CAS:Pal-Glu(OSu)-OH is a Liraglutide side chain, a GLP-1 agonist for type 2 diabetes study.Formula:C25H42N2O7Color and Shape:SolidMolecular weight:482.618Cholecystokinin (26-33) free acid
CAS:Cholecystokinin (26-33) free acid is part of CCK and induces mild taste aversion conditioning in rats.Formula:C49H61N9O14S2Purity:99.14%Color and Shape:SoildMolecular weight:1064.19[Sar9] Substance P
CAS:[Sar9]-Substance P is one of NK-1 receptor agonist. The action of SP on progesterone metabolism was mimicked by the rNK1-specific agonist [Sar-9,Met(O2)11]-SP.Formula:C64H100N18O13SPurity:98%Color and Shape:SolidMolecular weight:1361.66ANP [Des18-22] 4-23 amide rat
CAS:<p>ANP [Des18-22] 4-23 amide rat is a peptide fragment of rat atrial natriuretic peptide (ANP) that specifically binds to NPR-C.</p>Formula:C64H107N25O19S2Color and Shape:SolidMolecular weight:1594.82Pancreatic Polypeptide, bovine
CAS:Agonist at Y4 neuropeptide Y receptors.Formula:C186H287N53O56S2Purity:98%Color and Shape:SolidMolecular weight:4225.78A 71915
CAS:A 71915, an atrial natricuretic factor receptor antagonist, blocks physiological effects of angiotensin.Formula:C69H116N26O15S2Purity:98%Color and Shape:SolidMolecular weight:1613.97PSB-22269
PSB-22269 is identified as a GPR17 antagonist with a Ki value of 8.91 nM. It exhibits significant inhibitory effects in cAMP and G protein activation assays. Molecular docking studies indicate that the binding site of PSB-22269 includes positively charged arginine residues and a hydrophobic pocket. PSB-22269 promotes myelin regeneration strategies, offering potential for multiple sclerosis research.Formula:C26H21NO6Color and Shape:SolidMolecular weight:443.45YM 16638
CAS:YM 16638 is an LT antagonist that can be used to study antigen-induced early and late airway responses in allergic sheep.Formula:C18H22N2O5S3Purity:99.18%Color and Shape:SolidMolecular weight:442.57(±)5-iPF2α-VI
CAS:Isoprostanes are prostaglandin (PG)-like products of free-radical induced lipid peroxidation.Formula:C20H34O5Color and Shape:SolidMolecular weight:354.487Binospirone
CAS:Binospirone (MDL 73005EF) is a 5-HT1A receptor agonist with anxiolytic activity used in the study of movement disorders associated with neurologic dysfunction.Formula:C20H26N2O4Purity:97.57% - 98.96%Color and Shape:SoildMolecular weight:358.43Ref: TM-T71138L
1mg115.00€5mg275.00€10mg394.00€25mg615.00€50mg848.00€100mg1,121.00€200mg1,539.00€1mL*10mM (DMSO)34.00€Ebiratide
CAS:Ebiratide is an analog of ACTH 4-9.Formula:C48H73N11O10SPurity:98%Color and Shape:SolidMolecular weight:996.23SRI-37330
CAS:<p>SRI-37330 inhibits glucagon secretion and function, reduces hepatic glucose production, and reverses hepatic steatosis.</p>Formula:C16H19F3N4O2SPurity:99.65%Color and Shape:SolidMolecular weight:388.41NSC380324
<p>NSC380324 is a P2Y12 receptor antagonist with antiplatelet properties, which can be employed in research on atherosclerotic cardiovascular diseases.</p>Formula:C31H24N4O4Color and Shape:SolidMolecular weight:516.55[Tyr0] Corticotropin Releasing Factor, ovine
CAS:[Tyr^0] Corticotropin Releasing Factor, ovine, is a hypothalamic hormone sourced from sheep that prompts the secretion of adrenocorticotropic hormone (ACTH) andClotizolam
CAS:Clotizolam is a thienotriazolodiazepine derivative with PAF antagonistic properties, exhibiting sedative, anxiolytic, anticonvulsant, and muscle relaxant effects.Formula:C15H10Cl2N4SColor and Shape:SolidMolecular weight:349.24Endolide F
Endolide F (Compound 2) is a proline-containing lactone that serves as a moderate antagonist of the arginine vasopressin V1A receptor.Formula:C25H32N4O6Molecular weight:484.23218Substance P, Free Acid
CAS:Substance P, Free Acid is a synthetic analog of native Substance P, however, it lacks the biological activity exhibited by Substance P.Formula:C63H97N17O14SPurity:98%Color and Shape:SolidMolecular weight:1348.61(±)12-HEPE
CAS:(±)12-HEPE is produced by non-enzymatic oxidation of EPA.Formula:C20H30O3Color and Shape:SolidMolecular weight:318.457Lanepitant 2HCl
CAS:Lanepitant 2HCl is a non-peptide neurokinin-1 receptor antagonist that can be used to study painful neuropathy-like disorders such as migraine.Formula:C33H47Cl2N5O3Purity:98.67%Color and Shape:SolidMolecular weight:632.66Neuropeptide S(Rat)
CAS:Potent endogenous neuropeptide S receptor (NSPR) agonist (EC50 = 3.2 nM).Formula:C95H160N34O27Purity:98%Color and Shape:SolidMolecular weight:2210.52α-Bulnesene
CAS:α-Bulnesene, a novel PAF (platelet-activating factor) receptor antagonist, exhibits an IC50 of 17.62 μM. It can be isolated from patchouli. α-Bulnesene inhibits both PAF and arachidonic acid-induced aggregation of rabbit platelets.Formula:C15H24Color and Shape:SolidMolecular weight:204.35Relaxin H3 (human) TFA
Relaxin H3 (human) (TFA) is a relaxin peptide that exerts antifibrotic effects through the RXFP1 receptor.Formula:C237H374N70O69S6·xC2HF3O2PACAP (6-38), human, ovine, rat acetate
PACAP (6-38), human, ovine, rat acetate is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptorFormula:C184H303N55O48SPurity:99.84%Color and Shape:SoildMolecular weight:4085.841-39-Corticotropin (human)(TFA)
ACTH (1-39) human (TFA) is a melanocortin agonist that boosts adrenal CS production and affects the CNS and immune system.Formula:C207H308N56O58S·C2HF3O2Purity:98%Color and Shape:SolidMolecular weight:4655.16TAK-448 acetate
CAS:TAK-448 acetate (MVT-602 acetate) is a KISS1R agonist, a synthetic peptide similar to kisspeptin.Formula:C60H84N16O16Purity:99.88%Color and Shape:SolidMolecular weight:1285.41γ-1-Melanocyte Stimulating Hormone (MSH), amide
γ-1-Melanocyte Stimulating Hormone (MSH), amide, a peptide consisting of 11 amino acids, plays a critical role in regulating sodium (Na+) balance and bloodFormula:C72H97N21O14SColor and Shape:SolidMolecular weight:1512.9TH023
TH023 is an inhibitor of the TLR4 signaling pathway, specifically targeting the formation of TLR4 homodimers. In HEK-Blue hTLR4 cells, TH023 suppresses the secretion of embryonic alkaline phosphatase with an IC50 of 0.354 μM and inhibits NO expression in RAW264.7 cells, with an IC50 of 1.61 μM. Additionally, TH023 inhibits the activation of NF-κB and reduces the nuclear translocation of NF-κB p65. The compound demonstrates anti-inflammatory effects in a mouse model of LPS-induced acute sepsis and improves lung injury in mice.Formula:C22H21ClF2N4OColor and Shape:SolidMolecular weight:430.88
![[Ala17]-MCH acetate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1997L.webp&w=3840&q=75)
![[Sar9] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1862.webp&w=3840&q=75)
![ANP [Des18-22] 4-23 amide rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP3030.webp&w=3840&q=75)
