Amino Acids (AA)

<p>Please enquire for more information about SPLUNC1 (22-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-[15N]Leu-OH is a research chemical that has various applications in the field of biosynthesis and antibody production. It is commonly used in peptide synthesis and as a building block for the preparation of peptides and proteins. Fmoc-[15N]Leu-OH is known for its high purity and quality, making it an ideal choice for researchers and scientists working in the field of molecular biology. This compound can be easily dissolved in ethanol or other organic solvents, allowing for convenient use in laboratory experiments. With its unique characteristics and wide range of applications, Fmoc-[15N]Leu-OH is a valuable tool for those involved in biochemical research.</p>

<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TRAP-5 is a peptide consisting of the amino acid sequence H-Ser-Phe-Leu-Leu-Arg. This peptide has been shown to have antiviral, anti-inflammatory, and anticancer properties. It has also been found to inhibit platelet activation in vitro and to reduce atherosclerotic lesions in mice. TRAP-5 has been shown to have therapeutic potential for diseases such as heart disease and lung diseases, although its efficacy has not yet been tested in humans.</p>

<p>Please enquire for more information about (Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Osteocalcin (45-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about trans-4-Hydroxy-D-proline hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Secretin acetate salt H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala is a peptide that is secreted by the pancreas in response to the ingestion of food. Secretin stimulates the release of water and bicarbonate from the pancreas, as well as stimulating the gallbladder to contract, which results in increased flow of bile. Secretin also inhibits gastric acid secretion, slows intestinal motility, and stimulates pancreatic enzyme secretion. The amino acid sequence of this peptide is identical to that of leuprolide acetate (Lupron) and goserelin acetate (Zoladex), which are synthetic analogs with similar biological activity. This peptide can be synthesized on a solid phase or in solution phase. Solid phase synthesis involves attaching amino acids</p>

<p>Structure/Function: mouse, rat</p>

<p>Please enquire for more information about D-(-)-2-Chlorophenylglycine methyl ester hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Boc-Glu-phenyl ester is an inhibitor of bacterial protein synthesis. It was first synthesized as a synthetic substrate for the enzyme staphylococcal protease and has been shown to be active against both human and staphylococcal cells, with activity against strains resistant to other antibiotics. Boc-Glu-phenyl ester inhibits the synthesis of proteins by binding to the catalytic site of the enzyme and preventing formation of peptide bonds. This inhibition leads to cell death due to a lack of critical proteins required for cellular function. Boc-Glu-phenyl ester is also specific for staphylococci, which may be due to its ability to inhibit the production of epidermolytic exotoxins.</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-Bromo-1-methyl-4-(methylsulfonyl)benzene including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Glu-Val-Phe-OH is a cytosolic protein that has been shown to react with a number of reactive oxygen species. It reacts with electrons by forming a disulfide bond, which can be reduced back to the original molecule by the addition of an electron donor. This chemical reaction may be important in radiation or chemical toxicity. H-Glu-Val-Phe-OH has been used as a monoclonal antibody in pharmacokinetic modeling and pharmacodynamic studies, and has been shown to have low clearance and high volume of distribution, suggesting that this protein is concentrated in the cytosol. H-Glu-Val-Phe-OH also has pharmacokinetic properties that are not well understood, but it is thought to be eliminated from the body at a rate similar to ornithine.</p>

<p>Please enquire for more information about Fmoc-4-(neopentyloxysulfonyl)-Abu-OH (S)-2-(Fmoc-amino)-4-neopentyloxysulfonyl-butyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-DL-Lys(Z)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Succinyl-(Pro58,D-Glu65)-Hirudin (56-65) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-beta-Ala-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bz-Tyr-4-Abz-OH·sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Pro7)-Angiotensin I/II (1-7) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Asp(OcHex)-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5-(H-Gly-Pro-Gly-Pro-amido)-9-[di-(3-sulfonylpropyl)amino]-benzo[a]phenoxazonium perchlorate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Chloroac-DL-Phe-OH is an amino acid sequence that has been synthesized in the laboratory. It is a ligand that binds to surface antigens on cancer cells and inhibits multidrug efflux pumps. Chloroac-DL-Phe-OH is able to inhibit the translation of proteins by binding to the ribosome, preventing protein synthesis. In addition, it can reduce the flow rate of extracellular fluid, which may be useful for cancer therapy. This compound can also be conjugated with other drugs or molecules for delivery through the bloodstream.</p>

<p>Please enquire for more information about H-Ala-Phe-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Thr(PO3H2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3-Bromo-6-methylpicolinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide 6A is a cyclic peptide that has been shown to have analgesic and anti-inflammatory effects. It is synthesized by conjugating the amino acid alanine to the N-terminal of arginine, which leads to a polymer conjugate. The cyclic peptide has been shown to inhibit pain responses in anesthetized animals as well as inhibit blood pressure in rats with hypertension. In addition, it showed significant vasodilatory effects and inhibited sodium citrate induced platelet aggregation. Treatment with peptide 6A also decreases fibrinogen levels in humans and showed radical scavenging activities in human serum.</p>

<p>Please enquire for more information about H-Lys-Lys-Glu-Asp-Val-Val-Abu-Cys-Ser-Abu-Ser-Tyr-Lys-Lys-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Cys(Mob)-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3-(4-Methoxybenzoyl)acrylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin I is a peptide that belongs to the class of substances called angiotensins. This substance is found in many tissues and organs, including the brain, adrenal gland, and lung. Angiotensin I has been shown to be a pressor agent and also has biochemical effects on amino acid composition. The c-terminal sequence of this substance has been determined by incubating the molecule with pepsin at different pH values. The molecular weight of this substance is 938 Da and it has an amino acid composition of Asp-Arg-Val-Tyr-Val-His-Pro-Phe-His-Leu.</p>

<p>Please enquire for more information about Fmoc-Lys(Boc)-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Pro-Val-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Syndyphalin SD-33 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Preptin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1,2-Dilauroyl-rac-glycero-3-phosphocholine (DLPC) is a synthetic phospholipid that exhibits significant cytotoxicity against hyperproliferative cells. DLPC has been shown to inhibit the activity of the enzyme sphingosine 2-phosphate (S2P) and cell factor, both of which are important in signal transduction pathways. DLPC is capable of inducing phase transition at a temperature close to body temperature, making it biocompatible for use as a topical or injectable drug. It has also been shown to be effective in treating infectious diseases such as HIV and malaria, due to its ability to bind with basic proteins found on the surface of these viruses.</p>

<p>BPP 9a is an enzyme inhibitor that binds to the active site of angiotensin-converting enzyme (ACE) and blocks its activity. It is a nonsteroidal anti-inflammatory drug that has been shown to be effective in reducing inflammation and pain associated with arthritis, osteoarthritis, gout, and menstrual cramps. BPP 9a has also been shown to reduce blood pressure in a dose-dependent manner, which may be due to its ability to inhibit the synthesis of angiotensin II from angiotensin I. This inhibition may lead to decreased vascular tone and blood pressure. BPP 9a has also been shown to have beneficial effects on bowel disease and polymerase chain reaction (PCR) analysis of DNA.</p>

<p>Please enquire for more information about H-Glu-Thr-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Angiogenin (108-122) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anantin (linear sequence) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Val-Phe-OH is a peptide consisting of three amino acids, Valine, Phenylalanine and Hydroxyproline. It is a small molecule that has been shown to have an antihypertensive effect in rats. H-Val-Phe-OH binds to the dihydropyridine receptor on the cell membrane surface, which causes blood vessels to relax and contract. This action leads to decreased blood pressure. The high reactivity of H-Val-Phe-OH with other molecules makes it biodegradable, which means it can be broken down by water or enzymes into smaller molecules that are less harmful to the environment.</p>

<p>H-Leu-Met-NH2 is a catecholamine that is found in the central nervous system and functions as a neurotransmitter. It has been shown to induce contractile response when injected into the carotid artery, with a maximal effect at doses of 0.5-5 mg/kg. The effect of H-Leu-Met-NH2 on cardiovascular function has not been studied. Catecholamines are also involved in other physiological processes, including regulation of blood pressure and respiration. This compound was originally isolated from adrenal glands and is found in plants such as beans and peas. The structure of this compound can be described as an h-leu-[met]-amide with a hydrochloride salt at the c-terminus.</p>

<p>Please enquire for more information about H-Ala-Phe-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Lysine methyl ester 2HCl is a lysine derivative that has been synthesized by reacting L-lysine with methanol and hydrochloric acid. This compound's cytotoxicity has been demonstrated in an inhibition study using calf thymus dna. L-Lysine methyl ester 2HCl contains amide, acid, and ester linkages, as well as hydrogen bonds that are typical of natural compounds. It is also biologically active and has a molecular weight of 246.3 g/mol. The chemical structure of this compound consists of a central l-lysine molecule with two methyl groups on the nitrogen atom. The compound also contains a carboxyl group on the end of the chain and an ester group on the second carbon atom from the end of the chain. L-Lysine methyl ester 2HCl can be found in soybeans and bovine fetal tissue. It exhibits morphological properties similar to other</p>

<p>Please enquire for more information about H-Val-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Guanidine is a guanidinium cation that is used in the treatment of autoimmune diseases, cancer, and aspartyl receptor activity. Boc-guanidine is an efficient method for the synthesis of guanidine. It has been shown to be effective in treating inflammatory diseases and neutral pH conditions. Boc-guanidine inhibits glycogen synthase kinase-3 (GSK3) and membrane interactions, which are associated with a number of human disorders. It also has antimicrobial properties against marine microorganisms.</p>

<p>Please enquire for more information about Presenilin-1 (331-349)-Cys (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Antistasin-Related Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Ala-Ala-Lys-4MbetaNA formiate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-tBu-Gly-tBu-Gly-Asn(Me)2-Ala-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Ile-Tyr-Gly-Glu-Phe-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5-FAM-Woodtide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Leu-Thr-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Extracellular Death Factor is a molecule that binds to calmodulin, which is a protein found in all animal cells. Extracellular Death Factor can be used to induce apoptotic cell death in any type of cell, including cancer cells. The molecule is composed of three amino acids: H-Asn-Asn-Trp-Asn-Asn-OH. This compound has been shown to inhibit the replication of DNA and RNA in gram negative bacteria and tuberculosis cells. It also has an effect on the structural analysis of the molecule and causes light emission when exposed to ultraviolet light.</p>

<p>Please enquire for more information about Neuronostatin-13 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Leu-Leu-4,5-dehydro-Leu-aldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Asp(OtBu)-allyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C-Cys-Asp-Pro-Gly-Tyr-Ile-Gly-Ser-Arg is a cyclic peptide that is synthesized from the amino acid sequence of human epidermal growth factor (EGF). It has been shown to have in vitro and in vivo antitumor activity against melanoma cells. C-Cys-Asp-Pro-Gly-Tyr-Ile-Gly-Ser-Arg has also been shown to activate EGF receptors with physiological levels of EGF and to inhibit tumor metastasis.</p>

<p>Diphenyl(4-phenylthio)phenylsufonium hexafluorophosphate is a photoinitiator that is used in photopolymerization. It absorbs light at around 800 nm and emits light at around 810 nm. The initiator has a low molecular weight and is soluble in organic solvents, which makes it suitable for polymerization of acrylate monomers. Diphenyl(4-phenylthio)phenylsufonium hexafluorophosphate can be synthesized by the reaction of diphenyliodonium hexafluorophosphate with phenyldithiocarbonyl chloride.</p>

<p>Please enquire for more information about MAPKK2 (1-16) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Phe7)-Somatostatin-14 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Noopept is a peptide-like nootropic drug that belongs to the group of analogs of proline. It has been shown to have neuroprotective and cognitive enhancing effects in animal studies, as well as an antipsychotic effect. Noopept is a competitive antagonist of the glutamate receptor, and also has affinity for dopamine and serotonin receptors. Noopept is taken orally and penetrates into the brain quickly, where it interacts with different types of neurotransmitter systems. It also shows translational activity in vitro (in cell culture) and in vivo (in animals). This substance can be detected in human blood plasma following oral administration.</p>

<p>Please enquire for more information about Cyclo(-D-Tyr-Arg-Gly-Asp-Cys(carboxymethyl)-OH) sulfoxide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C-src is a protein kinase that plays an important role in cell signaling. The protein contains an ATP-binding domain and a catalytic domain, which are responsible for the phosphorylation of tyrosine residues on other proteins. C-src is involved in bone resorption, blood pressure control and tumor development. This molecule has been used as a template for the production of analogues with increased detection sensitivity (e.g., pp60 c-src (521-533) H-Thr-Ser-Thr-Glu-Pro-Gln).</p>

<p>Please enquire for more information about Z-Trp-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Gly-Tyr-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Tyr-Gln-Ser-Leu-Arg-Trp-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-Asp-Asp-Ile-Val-Pro-Cys-Ser-Met-Ser-3-nitro-Tyr-Thr-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Myelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Pro-D-Leu-D-Ala-NHOH is a neutralizing peptide that inhibits the activity of elastase and collagenase. It also has potent inhibitory activities against experimental infection with various microorganisms, including Streptococcus pyogenes, Staphylococcus aureus, and Pseudomonas aeruginosa. This peptide is a molecule consisting of 11 amino acids, which is synthesized in vivo by the host as a response to bacterial infections. Z-Pro-D-Leu-D-Ala-NHOH can be used for pharmaceutical preparations or techniques that require an enzyme inhibitor. The biological function of this peptide is not fully understood but it has been shown to have antiestrogenic effects.</p>

<p>Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin II is a peptide hormone that is involved in the regulation of blood pressure, water and electrolyte balance, and vascular resistance. It also plays a role in the development of angiogenic diseases such as cancer. Angiotensin II is an antagonist at the AT1 receptor, which is found on many tissues, including those in the brain, kidney, and vasculature. In addition to its effects on blood pressure and fluid retention, angiotensin II has been shown to affect intestinal motility and ileal absorption in rats. The inhibition of angiotensin II could be used for the treatment of neovascular diseases such as cancer.</p>

<p>H-Lys(Abz)-Pro-Pro-pNA is a potent and selective DPP-IV inhibitor that has been shown to be active in humans. This drug binds to the DPP-IV enzyme and prevents it from breaking down the incretin hormone, GLP-1, which is released by the intestine in response to food intake. This leads to increased insulin production and an improved glycemic profile in people with type 2 diabetes. H-Lys(Abz)-Pro-Pro-pNA also inhibits endoproteolysis of dipeptidyl peptidase IV (DPPIV), which reduces its activity against other enzymes such as amyloid beta protein precursor protein (APP) and angiotensin II receptor type 1 (AT1R).</p>

<p>H-Gly-Arg-Gly-Asp-Ser-Pro-Lys-OH is a peptide that has been shown to have chemotactic activity for monocytes and polymorphonuclear leucocytes, which are cells that participate in the inflammatory response. It also has biological properties that are reactive with hydroxyl groups and can be used to generate monoclonal antibodies. H-Gly-Arg-Gly-Asp-Ser-Pro-Lys-OH has been shown to stimulate the migration of galleria mellonella larvae, suggesting it may have potential as an antiinflammatory agent.</p>

<p>Acetate salt</p>

<p>Please enquire for more information about Z-Leu-Tyr-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-ACTH (4-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Arg-bNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-His(Bzl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Cys(Bzl)-Gly-OH trifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Tyr0)-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (73-84) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HCV NS4A Protein (22-34) (H strain) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>HIV protease is a large protein that cleaves the polyprotein of HIV. This enzyme is essential for viral replication and so any drug that inhibits its function will inhibit HIV infectivity. The HIV protease substrate III, which contains histidine at position 3, has been used to study the effects of HIV proteases on different tissue types. It has been shown that this substrate can be detected in the cytoplasm and vacuole of cells infected with HIV, indicating that it may be involved in the transport process. The addition of an acidic amino acid (p-nitro-phenylalanine) to the substrate increases its antiviral activity by increasing its stability against proteolytic enzymes and allowing it to penetrate into cells more easily.</p>

<p>Please enquire for more information about (Trp7,beta-Ala8)-Neurokinin A (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cholecystokinin-33 (10-20) (bovine, porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>