
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,465 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38248 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Boc-Phe-Leu-Phe-Leu-Phe-OH
CAS:<p>Boc-Phe-Leu-Phe-Leu-Phe-OH is a cyclase inhibitor that binds to the receptor molecule, which is part of the signaling pathway of chemotactic activity. It has been shown in vitro to inhibit the proliferation of diabetic retinopathy cells and to have chemotactic activity for polymorphonuclear leucocytes. Boc-Phe-Leu-Phe-Leu-Phe-OH is also an antagonist of chelerythrine, which is a potent activator of hl60 cells and a potent inhibitor of microbial infections.</p>Formula:C44H59N5O8Purity:Min. 95%Molecular weight:785.97 g/mol1-Oleoyl-3-palmitoyl-rac-glycero-2-phosphoethanolamine
CAS:<p>Please enquire for more information about 1-Oleoyl-3-palmitoyl-rac-glycero-2-phosphoethanolamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H76NO8PPurity:Min. 95%Molecular weight:718 g/mol2-[(4-Chloro-2-nitrophenyl)azo]-N-(2-methoxyphenyl)-3-oxobutanamide
CAS:<p>2-[(4-Chloro-2-nitrophenyl)azo]-N-(2-methoxyphenyl)-3-oxobutanamide is a chelating agent that has been used as a control agent in the manufacture of dyes, plastics, and rubber. It is also used as an additive in paints, textiles, and paper. 2-[(4-Chloro-2-nitrophenyl)azo]-N-(2-methoxyphenyl)-3-oxobutanamide is nonvolatile, nonflammable, and does not produce toxic byproducts when heated. This compound has low molecular weight with a molecular formula of C12H13NO5Cl. The structure of this compound includes two hydroxy groups (OH), one aliphatic hydrocarbon group (CH3), one carboxylic acid group (COOH), and three chlorine atoms (Cl). This product is soluble in water</p>Formula:C17H15ClN4O5Color and Shape:Yellow Clear LiquidMolecular weight:390.78 g/mol(Des-Gly10,His(Bzl)6,Pro-NHEt 9)-LHRH
CAS:<p>Please enquire for more information about (Des-Gly10,His(Bzl)6,Pro-NHEt 9)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H86N18O12Purity:Min. 95%Molecular weight:1,323.5 g/molTRH-Gly
CAS:<p>TRH-Gly Pyr-His-Pro-Gly-OH is a synthetic glucocorticoid that binds to the glucocorticoid receptor. It has been shown to be effective in inhibiting tumor growth and reducing the size of tumors in rats. TRH-Gly Pyr-His-Pro-Gly-OH has also been shown to reduce the release of calcium from intracellular stores, inhibit the biosynthesis of messenger RNA, and inhibit DNA synthesis in human tumor cells. It is used to treat patients with cancer and those with chronic obstructive pulmonary disease (COPD).</p>Formula:C18H24N6O6Purity:Min. 95%Molecular weight:420.42 g/molInsulin B (22-25)
CAS:<p>Please enquire for more information about Insulin B (22-25) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H35N7O5Purity:Min. 95%Molecular weight:525.6 g/molGLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt
CAS:<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C151H228N40O47·xC2H4O2Purity:Min. 95%Molecular weight:3,355.67 g/molH-Cys-Thr-Thr-His-Trp-Gly-Phe-Thr-Leu-Cys-OH (Disulfide bond)
CAS:<p>Disulfide bond is a protein that regulates muscle cell assembly and interactions. Disulfide bonds are formed by the oxidation of two cysteine molecules, which can be found in the extracellular matrix (ECM). The protein is an important regulator of metalloproteinases, which are enzymes that regulate ECM turnover. When disulfide bond lacks, it causes a deficiency in collagen production. Disulfide bond also has interactions with MMP-2, which plays a role in the regulation of arteriosclerosis and genetic disorders such as muscular dystrophy.</p>Formula:C52H71N13O14S2Purity:Min. 95%Molecular weight:1,166.33 g/mol(Des-Ala3)-GHRP-2
CAS:<p>Please enquire for more information about (Des-Ala3)-GHRP-2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H50N8O5Purity:Min. 95%Molecular weight:746.9 g/molZ-Tyr-Tyr-OH
CAS:<p>Please enquire for more information about Z-Tyr-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H26N2O7Purity:Min. 95%Molecular weight:478.49 g/molZ-Ala-Ile-OH
CAS:<p>Z-Ala-Ile-OH is a hydroxamic acid that is used in peptide synthesis. It is a monomer that is hydrophobic and has an affinity for peptidyl acceptors. The synthetic method for Z-Ala-Ile-OH involves the use of aspartic acid and aspartate semialdehyde, which are used to synthesize the hydroxamic acid via an amidation reaction. The nomenclature of Z-Ala-Ile-OH is based on its structure and the order of amino acids found in it. Aspartic acid and asparagine are both amino acids found in Z-Ala-Ile-OH, with the -NH2 group being replaced by -OH in this particular molecule. This substitution results in a more hydrophobic compound than aspartate semialdehyde.</p>Formula:C17H24N2O5Purity:Min. 95%Molecular weight:336.38 g/molH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:<p>H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when</p>Formula:C28H53N7O8Purity:Min. 95%Molecular weight:615.76 g/molFibrinopeptide B (human) trifluoroacetate salt
CAS:<p>Fibrinopeptide B is a fibrinogen-derived peptide that has shown to inhibit the growth of HL-60 cells. It may be active as a receptor antagonist for thrombin and caproic acid. Fibrinopeptide B also inhibits angiogenesis by inhibiting the binding of acidic, basic proteins to the vascular endothelium in atherosclerotic lesions. The biological sample can be obtained from human serum or plasma.</p>Formula:C66H93N19O25Purity:Min. 95%Molecular weight:1,552.56 g/molH-Glu-Glu-bNA
CAS:<p>H-Glu-Glu-bNA is a dipeptide with the amino acid sequence H-Glu-Glu. It has a carboxy group, which can react with 2-naphthylamine to form a chromogenic product. This peptide also contains an amine group that can be reacted with l-glutamyl-l-glutamic acid to form a carboxylic acid. The c-terminal of this peptide can react with an amino group from another dipeptide to form a condensation product.</p>Formula:C20H23N3O6Purity:Min. 95%Molecular weight:401.41 g/molH-Leu-Ala-Pro-OH
CAS:<p>Please enquire for more information about H-Leu-Ala-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H25N3O4Purity:Min. 95%Molecular weight:299.37 g/molZ-Gly-Ile-OH
CAS:<p>Please enquire for more information about Z-Gly-Ile-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H22N2O5Purity:Min. 95%Molecular weight:322.36 g/molBrain-Binding Peptide
CAS:<p>Please enquire for more information about Brain-Binding Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H64N12O14S2Purity:Min. 95%Molecular weight:965.11 g/molH-Glu-Tyr-Glu-OH
CAS:<p>Please enquire for more information about H-Glu-Tyr-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H25N3O9Purity:Min. 95%Molecular weight:439.42 g/molH-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH
CAS:<p>Please enquire for more information about H-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C46H79N17O11Purity:Min. 95%Molecular weight:1,046.23 g/molAngiotensin I/II (4-8)
CAS:<p>Angiotensin I/II (4-8) H-Tyr-Ile-His-Pro-Phe-OH is a peptide that contains the sequence of angiotensin I and II. It has been shown to have proton transport properties, which may be related to its sequence. The amino acid sequence of this peptide is similar to other pentapeptides such as insulin and vasopressin. This peptide has been linked to a vector that can cross the blood brain barrier, allowing it to act on the central nervous system.</p>Formula:C35H45N7O7Purity:Min. 95%Molecular weight:675.77 g/mol(S)-(+)-Glycidyl-4-nitrobenzoate
CAS:<p>Glycidyl-4-nitrobenzoate (GLYNB) is an opioid receptor ligand, which binds to the κ opioid receptor. It has been used in biological testing and has been shown to have affinity for the κ opioid receptor. GLYNB may be a useful tool for investigating the molecular diversity of this receptor and its function in both normal and pathological conditions.</p>Formula:C9H9NO6SPurity:Min. 95%Molecular weight:259.24 g/molH-D-Arg(Pbf)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-D-Arg(Pbf)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Diphenyl(4-phenylthio)phenylsufonium hexafluorophosphate
CAS:<p>Diphenyl(4-phenylthio)phenylsufonium hexafluorophosphate is a photoinitiator that is used in photopolymerization. It absorbs light at around 800 nm and emits light at around 810 nm. The initiator has a low molecular weight and is soluble in organic solvents, which makes it suitable for polymerization of acrylate monomers. Diphenyl(4-phenylthio)phenylsufonium hexafluorophosphate can be synthesized by the reaction of diphenyliodonium hexafluorophosphate with phenyldithiocarbonyl chloride.</p>Formula:C24H19S2•PF6Purity:Min. 95%Color and Shape:PowderMolecular weight:516.5 g/molAngiotensin I/II (3-8)
CAS:<p>Angiotensin I/II (3-8) H-Val-Tyr-Ile-His-Pro-Phe-OH is a peptide that has physiological effects and is used as a drug. It is an active analogue of the peptide hormone angiotensin II, which regulates blood pressure and fluid volume. Angiotensin I/II (3-8) H-Val-Tyr-Ile-His-Pro-Phe-OH binds to angiotensin receptors and stimulates the release of calcium ions from cytosolic stores in cells, leading to increased muscle contractions and vasoconstriction. This drug may also have effects on dopamine levels in the brain, locomotor activity, and biochemical properties such as enzyme activity or protein binding.br><br>Angiotensin I/II (3-8) H-Val-Tyr-Ile-His Pro Phe OH has been shown to reduce the level of dopamine</p>Formula:C40H54N8O8Purity:Min. 95%Molecular weight:774.91 g/molN-Methyl-N-((3R,4R)-4-methylpiperidin-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine
CAS:<p>Intermediate in the synthesis of tofacitinib</p>Formula:C13H19N5Purity:Min. 95%Molecular weight:245.32 g/molpTH (1-31) (human)
CAS:<p>Please enquire for more information about pTH (1-31) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C162H269N49O47S2Purity:Min. 95%Molecular weight:3,719.3 g/molFITC-β-Ala-Amyloid β-Protein (1-40)
CAS:<p>Please enquire for more information about FITC-beta-Ala-Amyloid beta-Protein (1-40) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C218H311N55O64S2Purity:Min. 95%Molecular weight:4,790.27 g/mol2-methyl-6-(trifluoromethyl)aniline
CAS:<p>2-Methyl-6-(trifluoromethyl)aniline is a colorless, oily liquid with a sulfurous odor. It is soluble in water and alcohol. The reaction rate of 2-methyl-6-(trifluoromethyl)aniline with sulfoxides is faster than that of benzyl anilines, but slower than that of anilino derivatives. The addition of hydrophobic groups to the 2-methyl-6-(trifluoromethyl)aniline molecule increases the reaction rate. 2-Methyl-6-(trifluoromethyl)aniline can be used as an anesthetic agent because it is a potent inhibitor of nerve conduction in sciatic nerves. It also has been shown to be effective in desulfurizing propylene, which is important for the production of polypropylene plastics and synthetic rubber. 2-Methyl-6-(triflu</p>Formula:C8H8F3NPurity:Min. 95%Molecular weight:175.15 g/mol4-Fluoro-2-methoxyaniline
CAS:<p>4-Fluoro-2-methoxyaniline is an inhibitor of tyrosine kinase. It is a molecule that has been isolated from the ground leaves of erythroxylon coca and is used in the treatment of diabetes mellitus. 4-Fluoro-2-methoxyaniline inhibits the growth factor receptor, epidermal growth factor (EGF), and its receptor, EGF receptor. This inhibition leads to decreased proliferation of epidermal cells and decreased insulin production by pancreatic beta cells. 4-Fluoro-2-methoxyaniline also has antioxidant properties, which may be due to its ability to scavenge free radicals.</p>Formula:C7H8FNOPurity:Min. 95%Color and Shape:Light Brown To Brown LiquidMolecular weight:141.14 g/mol(Ala11·22·28)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>(Ala11·22·28)-VIP is an endogenous peptide which is involved in the regulation of inflammation. It is a specific agonist for the vasoactive intestinal peptide receptor (VIP-R) and has been shown to exacerbate inflammatory responses such as those seen in tissues, intestines, and phagocytes. VIP also has effects on other cells types that are mediated by its ability to activate the VIP-R. These include increased vascular permeability and vasodilation, as well as increases in reactive oxygen species and cytokine production.</p>Formula:C139H231N43O39SPurity:Min. 95%Molecular weight:3,160.65 g/molZ-NHNH2·HCl
CAS:<p>Z-NHNH2·HCl is an amide containing a tetrapeptide. It has been used as a diagnostic agent for the detection of caerulein, a peptide that is produced by the pancreas in response to the presence of cholecystokinin (CCK). The monomers were prepared by reacting azide with benzyl chloroacetanilides and then cyclizing the product with triethylene glycol. The soybean extract was hydrolyzed with HCl to produce Z-NHNH2·HCl.</p>Formula:C8H10N2O2·HClPurity:Min. 95%Molecular weight:202.64 g/mol(Tyr0)-Stresscopin (human)
CAS:<p>Please enquire for more information about (Tyr0)-Stresscopin (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C204H335N57O55S2Purity:Min. 95%Molecular weight:4,530.33 g/molH-Glu(Gly-OH)-OH
CAS:<p>H-Glu(Gly-OH)-OH is a glutamic acid amide. It is used as a diagnostic reagent for the detection of spontaneous activity in cell cultures. H-Glu(Gly-OH)-OH is synthesized by reaction of glutamic acid with glycine and hydrochloric acid, followed by neutralization with sodium hydroxide. The compound can be analyzed using gel permeation chromatography and mass spectrometry methods. The stability of H-Glu(Gly-OH)-OH in solution has been validated by comparing it to other compounds that have similar properties, such as glutamate and glutamine. This compound has been found to be stable in urine samples at concentrations up to 10 mM for 24 hours at room temperature and pH 7.0.</p>Formula:C7H12N2O5Purity:Min. 95%Molecular weight:204.18 g/molAc-Pro-Leu-Gly-OH
CAS:<p>Ac-Pro-Leu-Gly-OH is a synthetic peptide that has been shown to be an effective crosslinker for thiols. Ac-Pro-Leu-Gly-OH is a water soluble, acidic peptide and can be used in biological systems as a crosslinker.</p>Formula:C15H25N3O5Purity:Min. 95%Molecular weight:327.38 g/molDL-Methionine methylsulfonium chloride
CAS:<p>DL-Methionine methylsulfonium chloride is a fine chemical that has many uses. It can be used as a versatile building block for research and synthesis of complex compounds, or as an intermediate for the production of speciality chemicals. DL-Methionine methylsulfonium chloride is also useful as a reaction component in organic synthesis and as a reagent in analytical chemistry. It is often used to introduce methionine residues into proteins, which are then used for structural studies and protein engineering. The quality of this compound is high and it has CAS number 3493-12-7.</p>Formula:C6H14ClNO2SColor and Shape:White PowderMolecular weight:199.7 g/molBz-Arg-betaNA·HCl
CAS:<p>Bz-Arg-betaNA·HCl is a fluorescent probe that binds to the active site of esterases. The fluorescence signal intensity is proportional to the amount of enzyme present and can be used for measuring the activity of esterases in vitro or in vivo. Bz-Arg-betaNA·HCl has been shown to have high specificity for esterases, with low affinity for other enzymes, such as proteases.</p>Formula:C23H25N5O2·HClPurity:Min. 95%Molecular weight:439.94 g/molH-D-Phe-Met-Arg-Phe-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-Met-Arg-Phe-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H42N8O4SPurity:Min. 95%Molecular weight:598.76 g/molZ-Leu-Leu-Arg-AMC
CAS:<p>Z-Leu-Leu-Arg-AMC is a proteolytic substrate that is used to study the activation of Th17 cells. It activates these cells by binding to the antigen peptide and protease activity, which are involved in the immune response. Z-Leu-Leu-Arg-AMC has been shown to induce autoimmune diseases in mice, as well as other conditions such as chronic inflammation and obesity. This compound also has a potential drug target for neutralizing acidity, which could be useful in treating cancer and other diseases. Z-Leu-Leu-Arg-AMC is stable at acidic pHs and can be used for biochemical studies of proteases at acidic pHs.</p>Formula:C36H49N7O7Purity:Min. 95%Color and Shape:PowderMolecular weight:691.82 g/molpTH (1-38) (human)
CAS:<p>Please enquire for more information about pTH (1-38) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C197H319N59O55S2Purity:Min. 95%Molecular weight:4,458.14 g/molZ-Ala-Ser-OMe
CAS:<p>Z-Ala-Ser-OMe is a peptide that is produced by catalyzed amide bond formation between the carboxylic acid group of Z-Ala and the amino group of Ser. This peptide has been shown to have a molecular weight of 564.2 and a melting point of 139°C. The peptides are coupled by d-amino acid residues to form chains, which are then esterified with acyl groups to yield Z-Ala-Ser-OMe.</p>Formula:C15H20N2O6Purity:Min. 95%Molecular weight:324.33 g/molCortistatin-29 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cortistatin-29 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C161H240N46O41S2Purity:Min. 95%Molecular weight:3,540.05 g/molFmoc-Arg(Pbf)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Arg(Pbf)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(2-Methylindol-1-yl)acetic acid·DCHA
CAS:Controlled Product<p>Please enquire for more information about (2-Methylindol-1-yl)acetic acid·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H11NO2·C12H23NPurity:Min. 95%Molecular weight:370.53 g/molH-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2
CAS:<p>H-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2 is a compound which is structurally related to the amino acid histidine. It has been used as an indicator for Xanthochromia, a diagnostic for copper. H-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2 has also been used in polyester production and as a monitoring agent for modifications of polylactic acid thermally.</p>Formula:C40H69N11O8Purity:Min. 95%Molecular weight:832.05 g/molFmoc-octyl-D-Gly-OH
CAS:<p>Fmoc-octyl-D-Gly-OH is a supramolecular polymer with a wide range of applications, including oil recovery and as a nanomaterial. Fmoc-octyl-D-Gly-OH is synthesized by the ring opening polymerization of octylglycol with D,L lactic acid. It has been shown to be an effective emulsifier in water, which may be due to its synergistic effect with other molecules. Fmoc-octyl-D-Gly-OH also has the ability to self assemble into a variety of morphologies such as nanoribbons, nanowires, and gel networks. This polymer can also be used as a hydrogenation catalyst for organic synthesis reactions that require high pressures and temperatures. Fmoc-octyl-D-Gly-OH has also been used in the production of ultrasonication devices for use in medicine.</p>Formula:C25H31NO4Purity:Min. 95%Molecular weight:409.52 g/molSuc-Ala-Phe-Lys-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Suc-Ala-Phe-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H39N5O8·C2HF3O2Purity:Min. 95%Molecular weight:735.7 g/molPDGF Antagonist
CAS:<p>H-Ala-Asn-Phe-Leu-Val-Trp-Glu-Ile-Val-Arg-Lys-Lys-Pro is a monoclonal antibody that inhibits proliferation of endothelial cells. It binds to PDGF, which is a potent growth factor. This drug has been shown to inhibit the growth of vascular smooth muscle cells in vitro and in vivo by inhibiting cholesterol synthesis. H-Ala-Asn-Phe-Leu-Val-Trp has also been shown to have antagonist effects on basic fibroblast growth factor and cyclic AMP, which are important mediators of choroidal neovascularization and blood vessel formation.</p>Formula:C77H122N20O17Purity:Min. 95%Molecular weight:1,599.92 g/molAc-Ile-Glu-Pro-Asp-pNA
CAS:<p>Ac-Ile-Glu-Pro-Asp-pNA is a synthetic peptide that has been shown to induce apoptosis in tumor cells. The peptide was found to cause cell lysis and necrotic cell death, which is associated with the activation of serine proteases. Ac-Ile-Glu-Pro-Asp-pNA also has been shown to have a toxicity profile similar to other apoptotic agents such as staurosporine, but it has not been tested for its ability to kill cancer cells without causing damage to healthy cells. Ac-Ile-Glu-Pro-Asp-pNA induces mitochondrial membrane depolarization and protein synthesis inhibition in K562 cells, which are human erythroleukemia cells. This peptide also has shown an ability to bind with monoclonal antibodies and inhibit the growth of casein.</p>Formula:C28H38N6O11Purity:Min. 95%Molecular weight:634.64 g/molH-Arg-Arg-Arg-Arg-OH acetate salt
CAS:<p>Acetate salt</p>Formula:C24H50N16O5Purity:Min. 95%Molecular weight:642.76 g/mol1,2-Distearoyl-sn-glycero-3-phosphatidic acid·disodium salt
CAS:<p>Please enquire for more information about 1,2-Distearoyl-sn-glycero-3-phosphatidic acid·disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H75Na2O8PPurity:Min. 95%Molecular weight:748.96 g/molH-Asn-Glu-OH
CAS:<p>H-Asn-Glu-OH is a reversed-phase high-performance liquid chromatography (RP-HPLC) stationary phase that has been used for the analysis of glutamic acid. It has been shown to be resistant to hydrogen fluoride and other organic solvents, and does not contain any detectable impurities. H-Asn-Glu-OH is made up of amino acids, such as glutamic acid, which can be detected by reverse phase HPLC.</p>Formula:C9H15N3O6Purity:Min. 95%Molecular weight:261.23 g/molAc-DL-Lys(Ac)-OH
CAS:<p>Please enquire for more information about Ac-DL-Lys(Ac)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H18N2O4Purity:Min. 95%Molecular weight:230.26 g/molH-Cys(Trt)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Cys(Trt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-α-Me-Lys(Boc)-OH
CAS:<p>Fmoc-a-Me-Lys(Boc)-OH is a versatile building block that can be used in the synthesis of complex compounds. It is a reagent and speciality chemical, which are substances used in research laboratories. Fmoc-a-Me-Lys(Boc)-OH has been used as an intermediate in the synthesis of drugs such as antihypertensive agents, anticonvulsants, and antibiotics. It has also been used as a reaction component in organic syntheses to produce peptides, polymers, and other compounds with biologically active properties.</p>Formula:C27H34N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:482.57 g/molFA-Gly-Phe-Leu-OH
CAS:<p>Please enquire for more information about FA-Gly-Phe-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29N3O6Purity:Min. 95%Molecular weight:455.5 g/molH-D-His(Bzl)-OH
CAS:<p>Please enquire for more information about H-D-His(Bzl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H15N3O2Purity:Min. 95%Molecular weight:245.28 g/molZ-Gly-Gly-NH2
CAS:<p>Z-Gly-Gly-NH2 is a synthetic peptide that has been shown to inhibit the activity of phosphatases, which are enzymes that hydrolyze phosphate groups from phosphorylated substrates. It is a hydrophobic and metal chelator, which makes it suitable for use in chromaffin cells and dorsal root ganglia. Z-Gly-Gly-NH2 has been shown to be specific for inhibition of synaptic phosphatase (PP1). This compound also inhibits the enzyme inhibitor subtilisin, which is found in bacteria such as Streptomyces or Bacillus subtilis. Z-Gly-Gly-NH2 has been shown to have a high affinity for receptors.</p>Formula:C12H15N3O4Purity:Min. 95%Molecular weight:265.27 g/molBoc-Met-Gly-OH
CAS:<p>Boc-Met-Gly-OH is an ester that can be synthesized by the reaction of Boc-glycine and methanol in aqueous sodium hydroxide. The product is soluble in organic solvents, such as dichloromethane, chloroform, and diethyl ether. Monitoring of this reaction yields the acid residues. The ester also has hydrophilic properties due to its amino group and methylene side chain. This compound can be used as a catalyst for reactions involving chloride or hydrophobic amino groups. It is not active for reactions with hydrophilic amino acids or immobilized catalysts.</p>Formula:C12H22N2O5SPurity:Min. 95%Molecular weight:306.38 g/molCyclo(-Asp(OMe)-Asp(OMe))
CAS:<p>Please enquire for more information about Cyclo(-Asp(OMe)-Asp(OMe)) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H14N2O6Purity:Min. 95%Molecular weight:258.23 g/molH-Ala-Abu-OH
CAS:<p>Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H14N2O3Purity:Min. 90%Color and Shape:PowderMolecular weight:174.2 g/molH-Tyr-Glu-Trp-OH
CAS:<p>Tyrosine is a non-essential amino acid that is an important component of proteins. It can also be synthesized in the body from the essential amino acid phenylalanine. Tyrosine is found in many foods and is made by plants, bacteria, and animals. The most common form of tyrosine in food is L-tyrosine. H-Tyr-Glu-Trp-OH is a neurotrophic factor that interacts with tyrosine kinase receptors to promote neuron survival and function. H-Tyr-Glu-Trp-OH has been shown to have neuroprotective effects in neonatal rats, preventing neuronal death due to genetic ablation or biochemical inhibition of neurotransmitter release.<br>Synaptic transmission refers to the propagation of nerve impulses across synapses, which are gaps between neurons. Neurotrophic factors are proteins produced by neurons that regulate the growth and maintenance of neurons.END> END></p>Formula:C25H28N4O7Purity:Min. 95%Molecular weight:496.51 g/molAc-Met-AMC
CAS:<p>Ac-Met-AMC is a nucleoside analog that is an active inhibitor of the enzyme DNA polymerase. This drug has been shown to be effective in preventing the growth of cancer cells in tissue cultures, and it has also been used to study the relationship between isoforms and oxygenated species. Ac-Met-AMC binds to the cytosolic side of the enzyme, which reduces its activity, but this binding does not affect the enzyme's ability to bind substrate or ATP. Ac-Met-AMC has been shown to hydrolyze with a rate constant of 6 x 10 M(-1) s(-1).</p>Formula:C17H20N2O4SPurity:Min. 95%Molecular weight:348.42 g/mol(2S,3S)-(-)-3-Amino-2-phenylpiperidine
CAS:<p>The process of asymmetric epoxidation is used to convert alkenes into epoxides in a single step. This reaction is catalyzed by the use of a chiral catalyst with an enantiomeric excess (ee) greater than 50%. The reactants are added to the catalyst and hydrogen peroxide, which oxidizes the alkenes. The resulting epoxides can be isolated from the reaction mixture by distillation or extraction. Factors that affect this reaction include the type of reactant, solvent, temperature, and pressure.</p>Formula:C11H16N2Purity:Min. 95%Molecular weight:176.26 g/molFmoc-N-Me-Asp(OBzl)-OH
CAS:<p>Please enquire for more information about Fmoc-N-Me-Asp(OBzl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H25NO6Purity:Min. 95%Color and Shape:PowderMolecular weight:459.49 g/molBoc-Gln-Pro-OH
CAS:<p>Please enquire for more information about Boc-Gln-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H25N3O6Purity:Min. 95%Molecular weight:343.38 g/molH-Ala-Phe-Ala-OH
CAS:<p>H-Ala-Phe-Ala-OH is a peptidomimetic that has been shown to have hydrogen bonding interactions with caco-2 cells. It also has the ability to form micelles and x-ray diffraction data show that the molecule has a right handed helical conformation. This compound was synthesized by reacting H-Ala-Phe with H-Gly-Gly in an amino acid condensation reaction, followed by hydrolysis of the amide bonds. The bioisosteres for this compound are tripeptides, which are amino acids linked by peptide bonds. The interaction of this compound with caco-2 cells is thought to be due to the hydrogen bonding interactions between this molecule and the hydroxyl groups on the cell surface.</p>Formula:C15H21N3O4Purity:Min. 95%Molecular weight:307.35 g/molFmoc-L-Lys(Alloc)-OH
CAS:<p>Fmoc-L-Lys(Alloc)-OH is a peptide that consists of an amino acid sequence that is a variant of the human insulin molecule. The peptide has been modified to incorporate a pegyl group, which increases the serum stability of this drug and prevents enzymatic degradation. This compound has been tested in vitro by binding to nuclear DNA and inhibiting receptor binding. Fmoc-L-Lys(Alloc)-OH has also shown anticancer effects in vivo with tumor xenografts and apoptosis protein expression in human serum, as well as an increase in serine protease activity.</p>Formula:C25H28N2O6Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:452.5 g/molH-Pro-His-Phe-OH
CAS:<p>H-Pro-His-Phe-OH is a proteolytic enzyme that belongs to the group of serine proteases. It is a member of the subtilisin family and has been used in research for its ability to cleave proteins at random. H-Pro-His-Phe-OH has been shown to hydrolyze lactococcal proteinase and other serine proteases, such as trypsin, chymotrypsin, and elastase.</p>Formula:C20H25N5O4Purity:Min. 95%Molecular weight:399.44 g/mol(Des-Gly10,D-His(Bzl)6,D-Leu7,Pro-NHEt 9)-LHRH acetate salt
CAS:Controlled Product<p>Please enquire for more information about (Des-Gly10,D-His(Bzl)6,D-Leu7,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H86N18O12Purity:Min. 95%Molecular weight:1,323.5 g/molHydrin 2
CAS:<p>Hydrin 2 is a member of the family of peptide hormones that are involved in the regulation of blood pressure. It is synthesized from two amino acids, H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Arg-Gly-Gly-. Hydrin 2 has been shown to have biological properties that are similar to those of angiotensin II and vasopressin. This peptide hormone is produced as a result of the action of hydrochloric acid on the precursor peptide, which is synthesized in the ventral and apical regions of the bladder. The reaction product is soluble in water and has been shown to be effective at treating wastewater.</p>Formula:C45H69N15O14S2Purity:Min. 95%Molecular weight:1,108.25 g/molCholecystokinin-33 (10-20) (bovine, porcine)
CAS:<p>Please enquire for more information about Cholecystokinin-33 (10-20) (bovine, porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H90N16O18Purity:Min. 95%Molecular weight:1,251.39 g/molPYX-1 trifluoroacetate salt
CAS:<p>Please enquire for more information about PYX-1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C70H105Cl2N19O16Purity:Min. 95%Molecular weight:1,539.61 g/molH-Gly-His-Arg-Pro-OH acetate salt
CAS:<p>H-Gly-His-Arg-Pro-OH acetate salt is a synthetic monoclonal antibody that binds to fibrinogen. It has been used in the production of a model protein and as an anticoagulant. H-Gly-His-Arg-Pro-OH acetate salt has been shown to inhibit the growth of tissue plasminogen activator, which is a growth factor for cells involved in blood clotting. This drug also inhibits the release of acetylcholine from nerve cells, which may be due to its ability to bind to plasma proteins.</p>Formula:C19H31N9O5Purity:Min. 95%Molecular weight:465.51 g/molH-Gly-Tyr-Ala-OH
CAS:<p>H-Gly-Tyr-Ala-OH is a hydrophobic, reactive molecule that has been shown to be unstable in the presence of light and air. This compound is synthesized by the sequence: Gly-Tyr-Ala. It has been found to be an exciplex with the photooxidation product, 2-aminoacetophenone. The molecular weight of H-Gly-Tyr-Ala-OH is constant and can be determined by electrospray mass spectrometry. This molecule has shown to have a strong interaction with ovary tissue and can also produce carboxylate ions in solution.</p>Formula:C14H19N3O5Purity:Min. 95%Molecular weight:309.32 g/molAc-(6-O-stearoyl)-muramyl-Ala-D-Glu-NH2
CAS:<p>Please enquire for more information about Ac-(6-O-stearoyl)-muramyl-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H66N4O12Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:758.94 g/molFmoc-b-Ala-Phe-Pro-OH
<p>Fmoc-b-Ala-Phe-Pro-OH is a chemical compound that is used as a reaction component, reagent, and useful scaffold. It reacts with various other chemicals to form complex compounds. This synthetic compound can be used as an intermediate in the synthesis of peptides, proteins, and other organic compounds. Fmoc-b-Ala-Phe-Pro-OH can also be used as a building block for the synthesis of speciality chemicals.</p>Formula:C32H33N3O6Purity:Min. 95%Color and Shape:PowderMolecular weight:555.62 g/molAnnexin A1 (1-11) (dephosphorylated) (human, bovine, chicken, porcine) trifluoroacetate salt
CAS:<p>Annexin A1 (1-11) is a peptide that is part of the annexin family. It is involved in the degranulation of cells and inhibits inflammation by inhibiting the production of pro-inflammatory cytokines. Annexin A1 (1-11) has been shown to be an anti-inflammatory compound as it binds to phospholipids on the surface of neutrophils, leading to inhibition of their chemotaxis and phagocytosis. This peptide also interacts with other annexins and prevents apoptosis by blocking caspase activity. Finally, it has been found that annexin A1 (1-11) can promote the healing of wounds in mice by accelerating reepithelialization and reducing scar formation. The concentration required for these effects are nanomolar concentrations.</p>Formula:C63H94N14O17SPurity:Min. 95%Molecular weight:1,351.57 g/mol(D-Thr6,D-Trp8·9,L-alaninol15)-Galanin (1-15)
CAS:<p>Please enquire for more information about (D-Thr6,D-Trp8·9,L-alaninol15)-Galanin (1-15) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C84H117N21O18Purity:Min. 95%Molecular weight:1,708.96 g/molN-Methyl-1-propanamine
CAS:<p>N-Methyl-1-propanamine is a compound made up of ethylene diamine and activated chlorine. It has been used as a model system to study the biological properties of amines. This compound has been shown to have anti-cancer effects in human serum and is active against inflammation diseases. N-Methyl-1-propanamine is soluble in water, but not in ethanol or acetone. It has a pH optimum at 10 and decomposes at temperatures higher than 120°C. The activation energies for the reactions of this compound with hydrogen bond acceptors, such as alcohols and ethers, are relatively low (around 20 kcal/mol).</p>Formula:C4H11NPurity:Min. 95%Molecular weight:73.14 g/molL-Cysteine hydrochloride anhydrous
CAS:<p>L-Cysteine hydrochloride anhydrous is an amino acid that is used in the treatment of bowel disease. It is also a precursor for glutathione, which has antioxidant properties and helps maintain iron homeostasis. L-Cysteine hydrochloride anhydrous has been shown to inhibit the oxidation of proteins by reacting with reactive oxygen species (ROS) such as nitric oxide, superoxide, and hydrogen peroxide. This amino acid also interacts with toll-like receptor 4 (TLR4), which may account for its natural anti-inflammatory properties. L-Cysteine hydrochloride anhydrous can be synthesized from cysteine and glutamic acid using a CDNA clone encoding the enzyme cystathionine β-synthase. The synthesis of this amino acid requires a number of biochemical reactions including hydrogen bonding interactions with inhibitor molecules such as dihydrofolate reductase, metalloproteases, and thiored</p>Formula:C3H7NO2S·HClColor and Shape:White Off-White PowderMolecular weight:157.62 g/molFmoc-Nle-Nle-OH
CAS:<p>Please enquire for more information about Fmoc-Nle-Nle-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H34N2O5Purity:Min. 95%Molecular weight:466.57 g/molN-2-Ethoxyethyl-Val-Ala-anilide
CAS:<p>Please enquire for more information about N-2-Ethoxyethyl-Val-Ala-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H29N3O3Purity:Min. 95%Molecular weight:335.44 g/molH-Gly-Phe-bNA
CAS:<p>H-Gly-Phe-bNA is a dinucleotide phosphate that is activated by phosphatase to form an active nucleotide. This nucleotide inhibits the polymerase chain reaction (PCR) by binding to the template DNA strand and preventing the addition of nucleotides by the DNA polymerase. The monoclonal antibody recognizes H-Gly-Phe-bNA and binds it in a radioactive assay, inhibiting the activity of this dinucleotide phosphate. Radiation causes H-Gly-Phe-bNA to produce reactive oxygen species, which can induce DNA damage or cause cell death. This nucleotide also has an acidic pH optimum for its activity, making it useful in acidic environments such as lysosomes. H-Gly-Phe-bNA also binds to cation channels and is localized primarily in the cytosol, with some found in mitochondria or microsomes. It also has a high affinity for calcium ions</p>Formula:C21H21N3O2Purity:Min. 95%Molecular weight:347.41 g/molEndothelin-3 (human, mouse, rabbit, rat) acetate
CAS:<p>Acetate salt</p>Formula:C121H168N26O33S4•(C2H4O2)xPurity:Min. 95%Molecular weight:2,643.05 g/molMoth Cytochrome C (MCC) Fragment
CAS:<p>Please enquire for more information about Moth Cytochrome C (MCC) Fragment including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H129N23O26Purity:Min. 95%Molecular weight:1,805 g/molHippuryl-His-Leu-OH
CAS:<p>Hippuryl-His-Leu-OH is a peptide that inhibits the activity of angiotensin converting enzyme (ACE) at a concentration of 50 μM. It has been shown to inhibit cyclase and other enzymes in vitro. The binding of this compound to ACE prevents the conversion of angiotensin I to angiotensin II, which is a potent vasoconstrictor. Hippuryl-His-Leu-OH also has inhibitory properties against atrial natriuretic peptide (ANP), and can be used as an antihypertensive agent. This drug has been shown to have growth factor β1 activities, and can be used for the treatment of cardiac diseases such as myocardial infarction. Structural analysis shows that this drug binds to the active site of ACE, inhibiting its activity by blocking access to substrate or by altering substrate specificity.</p>Formula:C21H27N5O5Purity:Min. 95%Color and Shape:White PowderMolecular weight:429.47 g/molNeuropeptide W-30 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide W-30 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H249N49O37SPurity:Min. 95%Molecular weight:3,543.12 g/molAcetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H176N26O30S2Purity:Min. 95%Molecular weight:2,478.93 g/molFmoc-D-Cys(Mtt)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Cys(Mtt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H33NO4SPurity:Min. 95%Molecular weight:599.74 g/molFmoc-Gln(Trt)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Gln(Trt)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Z-His-p-nitro-Phe-Phe-OMe
CAS:<p>Please enquire for more information about Z-His-p-nitro-Phe-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H34N6O8Purity:Min. 95%Molecular weight:642.66 g/molH-Glu-Ala-pNA
CAS:<p>Please enquire for more information about H-Glu-Ala-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H18N4O6Purity:Min. 95%Molecular weight:338.32 g/molFmoc-Ala-Ala-Pro-OH
CAS:<p>Fmoc-Ala-Ala-Pro-OH is a building block that is used in organic synthesis as a reaction component or reagent. It can be used to synthesize a wide range of complex compounds with speciality chemical and fine chemical applications. Fmoc-Ala-Ala-Pro-OH is also a versatile building block that can be used to synthesize various useful scaffolds, such as the Fmoc amino acid sequence, which has been shown to bind heparin. This compound has high purity and can be used in research and development.</p>Formula:C26H29N3O6Purity:Min. 95%Color and Shape:PowderMolecular weight:479.53 g/molZ-Gly-Pro-pNA
CAS:<p>Z-Gly-Pro-pNA is a synthetic substrate that has been used in the development of polyclonal antibodies against the surface protein of Stenotrophomonas maltophilia. The antibody, when immobilized to an insoluble support, was able to detect the bacterial cells within 10 hours. Z-Gly-Pro-pNA is a cyclic peptide with a proteolytic activity and an acidic pH optimum. It has been shown that Z-Gly-Pro-pNA can be hydrolysed by serine proteases such as trypsin and chymotrypsin.</p>Formula:C21H22N4O6Purity:Min. 95%Molecular weight:426.42 g/molAcetyl-ACTH (7-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (7-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H170N32O21Purity:Min. 95%Molecular weight:2,240.7 g/mol(His(3-Me)2)-TRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (His(3-Me)2)-TRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H24N6O4Purity:Min. 95%Molecular weight:376.41 g/molBiotinyl-Substance P trifluoroacetate salt
CAS:<p>Biotinyl-Substance P trifluoroacetate salt Biotinyl-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 trifluoroacetate salt is a biotin conjugated Substance P analog. It is designed to bind to the amino acid sequences in the brain that are responsible for controlling and regulating pain. The drug's amino acid sequence was designed by accessing databases of amino acid sequences from all known organisms. The drug is administered as a sequence of cassettes, each containing an acid molecule that can be transferred to cells through nucleotide transfer.</p>Formula:C73H112N20O15S2Purity:Min. 95%Molecular weight:1,573.93 g/mol1-t-Boc-piperidine-4-spiro-5'-[1',3'-bis-t-boc]-hydantoin
CAS:<p>Please enquire for more information about 1-t-Boc-piperidine-4-spiro-5'-[1',3'-bis-t-boc]-hydantoin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H35N3O8Purity:Min. 95%Molecular weight:469.53 g/molBoc-Gly-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Gly-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Arg-Tyr-NH2·2 HCl
CAS:<p>Please enquire for more information about H-Arg-Tyr-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H24N6O3·2HClPurity:Min. 95%Molecular weight:409.31 g/molHIV (gp120) Fragment (308-331)
CAS:<p>HIV is a type of virus that causes AIDS. HIV infects the cells of the human immune system, destroying them and making the body vulnerable to infections from other types of viruses and bacteria. The gp120 protein is an envelope glycoprotein that mediates binding to the CD4 receptor on host T-helper cells and induces fusion of viral and cellular membranes. The gp120 protein has been studied using a variety of methods, including neutralizing antibody binding experiments, enzyme-linked immunosorbent assays (ELISA), Western blotting, peptide mapping, and density lipoprotein binding assays. This fragment contains residues 308-331 in a human immunodeficiency virus (HIV) type 1 gp120 protein.</p>Formula:C114H199N41O31Purity:Min. 95%Molecular weight:2,640.06 g/molHIV-1 rev Protein (34-50)
CAS:<p>Please enquire for more information about HIV-1 rev Protein (34-50) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H173N51O24Purity:Min. 95%Molecular weight:2,437.74 g/molH-Ala-Ala-Pro-Ala-OH
CAS:<p>H-Ala-Ala-Pro-Ala-OH is a tetrapeptide that inhibits elastase, an enzyme that breaks down elastin. This compound has been shown to have anti-elastolytic activity in vitro and in vivo. H-Ala-Ala-Pro-Ala-OH was administered intraperitoneally to hamsters with induced emphysema, resulting in a decrease of elastin abnormalities and improvement of the ultrastructure of the lungs. It also improves pancreatic morphology and function in porcine pancreatitis models.</p>Formula:C14H24N4O5Purity:Min. 95%Molecular weight:328.36 g/molZ-Glu-Tyr-OH
CAS:<p>Z-Glu-Tyr-OH is a disulfide bond with a cavity. It is soluble in acidic solutions and has a cationic surface. Z-Glu-Tyr-OH is an enzyme inhibitor that blocks the activity of α subunit of protein kinase C, which is involved in intracellular signal transduction pathways. The inhibition of this enzyme may lead to apoptosis, or programmed cell death. Z-Glu-Tyr-OH also inhibits fatty acid synthesis by blocking the activity of hydroxylase enzymes, such as 3β-hydroxysteroid dehydrogenase and 17α-hydroxylase. This compound has been shown to inhibit indole-3-propionic acid production by inhibiting the kinetic and sephadex g-100 activities of the enzyme indoleamine 2,3 dioxygenase.</p>Formula:C22H24N2O8Purity:Min. 95%Molecular weight:444.43 g/molH-Gly-Gly-Met-OH
CAS:<p>H-Gly-Gly-Met-OH is a hydrophobic amino acid with a decelerated reaction. It has been shown to modulate the growth of organisms, such as Staphylococcus aureus and Streptococcus pneumoniae. This molecule also has aspirin-like activity against S. aureus and can be used for cavity prevention. H-Gly-Gly-Met-OH is effective in inhibiting the growth of S. aureus, but not against Streptococcus pneumoniae. The test organism used in this study was Escherichia coli K12. H-Gly-Gly-Met-OH has been shown to have sequences that are similar to those found in kinetically slow peptides and tripeptides, which may explain its stability when encapsulated in liposomes for oral administration.</p>Formula:C9H17N3O4SPurity:Min. 95%Molecular weight:263.32 g/molDynorphin A (1-8) acetate salt
CAS:<p>Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt is a synthetic, nonpeptide opioid agonist. It binds to the delta receptor and inhibits nociception in the central nervous system. This compound has been shown to produce acute phase and subchronic toxicity in rats and has been shown to possess antinociceptive effects in mice. Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt has also been shown to antagonize the enzyme inhibitors of phospholipase A2, cyclooxygenase, and lipoxygenase.<br>MECHANISM OF ACTION: Dynorphin A (1–8) is an endogenous peptide that modulates neurotransmission at the</p>Formula:C46H72N14O10Purity:Min. 95%Molecular weight:981.15 g/molH-Gly-Gly-NH2·HCl
CAS:<p>Gly-Gly-NH2·HCl is a nanosized antibiotic that has been shown to have antibacterial properties. It is activated by long-chain inorganic acids, such as hydrochloric acid, and organic solvents, such as acetone. This compound has an amide group that makes it acidic. The hydrocarbon chain of this molecule may be either short or long.</p>Formula:C4H9N3O2·HClPurity:Min. 95%Molecular weight:167.59 g/molAloc-Ala-OH·DCHA
CAS:<p>Aloc-Ala-OH·DCHA is a linker that can be utilized in nucleotide synthesis. It is synthesized by reacting the amine group of alanine with the acid chloride of DCHA. The product of this reaction, Aloc-Ala-OH·DCHA, is an amide bond with a free hydroxyl group on one end and a free amino group on the other end. The C-terminal carboxylic acid function of this compound reacts with phosphoramidite to yield the desired n-terminal threonine residue. This linker can also be used to conjugate other compounds such as nucleosides or phosphodiester bonds.</p>Formula:C7H11NO4·C12H23NPurity:Min. 95%Color and Shape:SolidMolecular weight:354.48 g/molPyr-Trp-OH
CAS:<p>Pyr-Trp-OH is a derivative of tryptophan. It has been found to be active in the brain and its metabolites have been shown to inhibit superoxide production by inhibiting the activity of hydroxylase and dismutase. Pyr-Trp-OH also inhibits serotonin synthesis, which may contribute to its antidepressant properties. Pyr-Trp-OH is an inhibitor of indoleamine 2,3 dioxygenase, an enzyme that converts tryptophan into kynurenine. This process generates hydrogen peroxide, which can lead to cell death. The conversion of tryptophan into serotonin also produces hydrogen peroxide, so it is possible that Pyr-Trp-OH may have antioxidant effects as well as antidepressant effects.</p>Formula:C16H17N3O4Purity:Min. 95%Molecular weight:315.32 g/molH-Glu-Glu-OH
CAS:<p>H-Glu-Glu-OH is an organic acid that has proteolytic and gene product properties. It is a hyperactive compound that can be used as a sample preparation reagent for the detection of glutamic acid in proteins. H-Glu-Glu-OH inhibits protein synthesis by binding to ribosomes, which are responsible for the production of proteins in the cell, and prevents their function. Magnetic resonance spectroscopy has been used to investigate the uptake of H-Glu-Glu-OH into mammalian cells and ovarian follicles.</p>Formula:C10H16N2O7Purity:Min. 95 Area-%Color and Shape:White PowderMolecular weight:276.24 g/molSubstance P (4-11)
CAS:<p>Substance P (4-11) H-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 is a fluorescent peptide that binds to calcium and chloride ions. It has been shown to have an affinity for both peptide and calmodulin binding. This peptide has also been shown to be highly heat stable and can be used in a wide range of temperatures. The substance P (4-11) sequence is found in porcine, rat, bovine, and human proteins. The amino acid sequence is composed of 4 amino acids: proline, glutamine, phenylalanine, and leucine. This peptide's optimum pH is 7.5 with a temperature range of 35°C to 45°C. It has been shown that the activity of this peptide decreases as the concentration increases. It has also been shown to be susceptible to aminopeptidases at high concentrations or when</p>Formula:C46H67N11O10SPurity:Min. 95%Molecular weight:966.16 g/molZ-Ala-Val-OH
CAS:<p>Z-Ala-Val-OH is a prodrug that is hydrolyzed to ala-z-valine in vivo. It has been shown to be resistant to enzymes such as esterases, amidases, and proteases. Z-Ala-Val-OH has been modified in an effort to increase its affinity for the active site of the enzyme. This modification involves attaching a hydrophobic group onto the amide nitrogen of the amino acid residue. The resulting product is an active ester that can be used as an antihypertensive drug or for the treatment of Alzheimer's disease.</p>Formula:C16H22N2O5Purity:Min. 95%Molecular weight:322.36 g/molAc-Pen-Arg-Gly-Asp-Cys-OH (Disulfide bond)
CAS:<p>Disulfide bond is an analytical method for the determination of the concentration-time curve. It is a cyclic peptide that competes with fibrinogen for binding to platelets. Disulfide bond has been shown to be an antagonist of receptor antagonist, and has potential applications in the treatment of autoimmune diseases. Disulfide bond can also be used as a model system for toxicological studies and experimental models in humans.</p>Formula:C22H36N8O9S2Purity:Min. 95%Molecular weight:620.7 g/molGLP-2 (1-34) (human) trifluoroacetate salt
CAS:<p>Structure/Function: human; Trifluoroacetate salt</p>Formula:C171H266N48O56SPurity:Min. 95%Molecular weight:3,922.3 g/molAc-Asp-Arg-Leu-Asp-Ser-OH
CAS:<p>Ac-Asp-Arg-Leu-Asp-Ser-OH is a peptide that has been synthesized to mimic the activity of aspartic acid. It has been shown to have prophylactic and/or therapeutic effects on infectious diseases and autoimmune diseases. Ac-Asp-Arg-Leu-Asp-Ser-OH may be used for the treatment of cancer, inflammatory diseases, and neurodegenerative diseases. Ac-Asp-Arg-Leu-Asp-Ser OH also acts as a cryoprotectant and diluent in drug development.</p>Formula:C25H42N8O12Purity:Min. 95%Molecular weight:646.65 g/molBoc-Gly-Gly-Gly-Lys-OH
CAS:<p>Please enquire for more information about Boc-Gly-Gly-Gly-Lys-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H31N5O7Purity:Min. 95%Molecular weight:417.46 g/mol(R,S)-α-Amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid hydrobromide
CAS:<p>(R,S)-AMPA is a synthetic analog of the excitatory neurotransmitter glutamate, specifically designed to activate AMPA receptors, a subtype of ionotropic glutamate receptors. These receptors are pivotal in mediating fast synaptic transmission in the central nervous system. (R,S)-AMPA serves as a prototypical agonist for AMPA receptors, facilitating the study of receptor function and synaptic plasticity.</p>Formula:C7H10N2O4•HBrPurity:Min. 95%Molecular weight:267.08 g/molAtrial Natriuretic Factor (3-28) (rat) trifluoroacetate salt
CAS:<p>Natriuretic factor is a peptide hormone that regulates blood pressure. This peptide is encoded by a gene located on chromosome 10 and is made up of 28 amino acids. Natriuretic factor binds to the membrane of mitochondria and zymogen granules, causing them to release their contents into the cytosol. The resulting increase in cytosolic volume causes an increased diastolic pressure, as well as an increased glomerular filtration rate and cardiac output. Natriuretic factors have also been shown to stimulate the production of natriuretic peptides, which are involved in water balance and electrolyte homeostasis.</p>Formula:C119H189N43O36S2Purity:Min. 95%Molecular weight:2,862.17 g/molZ-Gly-Pro-Arg-AMC·HCl
CAS:<p>Please enquire for more information about Z-Gly-Pro-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H37N7O7·HClPurity:Min. 95%Molecular weight:656.13 g/molTRAP-6 ammonium acetate salt
CAS:<p>TRAP-6 is a biocompatible polymer that is used to prevent adhesion of platelets to the endothelium and activation of coagulation. TRAP-6 has been shown to be effective in preventing inflammatory bowel disease, as well as other bowel diseases, by inhibiting the release of inflammatory cytokines such as fibrinogen and erythropoietin. This drug has been shown to have clinical relevance in treating inflammatory bowel disease in animal models. TRAP-6 can also be used to inhibit the growth of bacteria by binding to bacterial cells or by inducing their death. In addition, TRAP-6 can bind with monoclonal antibodies and target specific cells for destruction.</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/moltert-Butyl6-[(1e)-2-[4-(4-fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-di oxane-4-acetate
CAS:<p>Please enquire for more information about tert-Butyl6-[(1e)-2-[4-(4-fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-di oxane-4-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H40FN3O6SPurity:Min. 95%Molecular weight:577.71 g/molN-[(RS)-1-Carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt
CAS:<p>The N-[(RS)-1-carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt is a synthetic substrate for the study of metalloendopeptidase. This compound was used to develop a model system to study the function of human liver, and has been shown to inhibit the growth of PC12 cells. The N-[(RS)-1-Carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH trifluoroacetate salt is also an experimental model for congestive heart failure. This compound has been shown to increase glomerular filtration rate in experimental animals as well as basic fibroblast growth factor activity in cell culture by increasing intracellular calcium levels.</p>Formula:C32H36N4O7Purity:Min. 95%Molecular weight:588.65 g/molN-(2-Carbamoyl-ethyl)-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-(2-Carbamoyl-ethyl)-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H32N4O3Purity:Min. 95%Molecular weight:376.49 g/molTRAP-6 amide trifluoroacetate salt
CAS:<p>Protease-activated receptor 1 (PAR-1) selective activating peptide, TFA salt. 98%.</p>Formula:C34H57N11O8Purity:Min. 95%Color and Shape:PowderMolecular weight:747.89 g/molO-Methylisourea hemisulfate
CAS:<p>O-Methylisourea hemisulfate is a chemical compound that has been used for wastewater treatment and as an anticancer agent. It is known to have multiple-reaction monitoring (MRM) techniques which are based on the detection of the reaction products with multiple wavelengths. O-Methylisourea hemisulfate has been shown to have anticancer activity in mammalian cells, and it enhances the antibacterial effect of ethyl formate. This chemical is also used as a sample preparation reagent in human serum protein analysis.</p>Formula:C2H6N2O·H2O4SMolecular weight:246.24 g/molAnthranilyl-HIV Protease Substrate III trifluoroacetate salt
CAS:<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate III trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H100N20O17Purity:Min. 95%Molecular weight:1,433.61 g/mol6-Diazo-5-oxo-L-norleucine
CAS:<p>Inhibitor of hexosamine biosynthetic pathway</p>Formula:C6H9N3O3Purity:Min. 95%Color and Shape:Slightly Yellow PowderMolecular weight:171.15 g/mol4-Hydroxymethyl-5-methyl-2-phenylimidazole
CAS:<p>4-Hydroxymethyl-5-methyl-2-phenylimidazole is an impurity of phenoxy. It has a high resistance to acids and bases, and can be used in devices that require high purity. 4-Hydroxymethyl-5-methyl-2-phenylimidazole has a particle diameter of about 1 micron. This impurity is metastable, or stable only under certain conditions such as temperature and pressure. The high viscosity of this compound makes it useful for devices that require a high degree of stability at elevated temperatures. Immediate decomposition occurs when exposed to air due to the presence of naphthalene, phosphine, and silicon.</p>Formula:C11H12N2OPurity:Min. 95%Molecular weight:188.23 g/molH-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt
<p>Please enquire for more information about H-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H62N14O16SPurity:Min. 95%Molecular weight:1,051.09 g/molMethyltetrazine amine
CAS:<p>A building block used for derivatization of carboxylic acids or activated esters with methytetrazine moiety. The stability of Methyltetrazine Amine is substantially improved compared to hydrogen substituted tetrazine-tmine. Superior stability of methyltetrazine-amine allows this reagent to be used in wider range of chemical transformations. Long-term storage of methyltetrazine-amine, especially in aqueous buffer, is also greatly improved compared to Tetrazine Amine.Supplied as the HCl salt</p>Formula:C10H11N5Purity:Min. 95%Color and Shape:PowderMolecular weight:201.23 g/molH-Met-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Met-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Bz-DL-Arg-AMC·HCl
CAS:<p>Please enquire for more information about Bz-DL-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H25N5O4·HClPurity:Min. 95%Molecular weight:471.94 g/molACTH (4-10) trifluoroacetate salt
CAS:<p>ACTH (4-10) trifluoroacetate salt is a cholinergic agent that belongs to the class of neurotransmitters. It is synthesized from the naturally occurring hormone ACTH, which is released by the anterior pituitary gland in response to a variety of stimuli. This compound has been shown to have physiological effects on various organs, including adipose tissue and locomotor activity. It also shows neuroprotective effects in animal models and has neurotrophic properties. The therapeutic potential of this compound for brain functions is currently being explored.</p>Formula:C44H59N13O10SPurity:Min. 95%Molecular weight:962.09 g/molPAR-2 (6-1) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/mol2-(4-Methyl-2-phenyl-1-piperazinyl)-3-pyridinemethanol
CAS:<p>2-(4-Methyl-2-phenyl-1-piperazinyl)-3-pyridinemethanol is an impurity in hexane that is generated during the reaction of pyridine with acetonitrile. The impurity is removed by crystallizing it from methanol. 2-(4-Methyl-2-phenyl-1-piperazinyl)-3-pyridinemethanol has a high efficiency, and can be used to synthesize hexamethyldisiloxane. This product can be used as a metal catalyst for reactions involving alkali metals or metal halides. It can also be used as an alcohol solvent, but not hydrogenated.</p>Formula:C17H21N3OPurity:Min. 95%Color and Shape:White to off white powderMolecular weight:283.37 g/molNeuromedin S (human) trifluoroacetate salt
<p>Please enquire for more information about Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H265N53O44Purity:Min. 95%Molecular weight:3,791.29 g/molZ-Gly-Ala-His-AMC
CAS:<p>Please enquire for more information about Z-Gly-Ala-His-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H30N6O7Purity:Min. 95%Molecular weight:574.58 g/molNeuropeptide Y-Lys(biotinyl) (free acid) (human, rat) trifluoroacetate salt
<p>Please enquire for more information about Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C205H310N58O61S2Purity:Min. 95%Molecular weight:4,627.14 g/molZ-Phe-Phe-diazomethylketone
CAS:<p>Z-Phe-Phe-diazomethylketone is a cathepsin inhibitor that has been shown to inhibit the proteolytic activity of various enzymes, including serine proteases and thrombotic thrombocytopenic. This compound inhibits the growth of Leishmania parasites in cell culture and has been shown to have a high affinity for carboxy terminal and proximal tubules. Z-Phe-Phe-diazomethylketone has a neutral pH, with an optimum at 7.0, which may be due to its ability to bind to proteins or other components of cells without affecting their functions.</p>Formula:C27H26N4O4Purity:Min. 95%Molecular weight:470.52 g/molNuclear Factor NF-KB Inhibitor SN50 trifluoroacetate salt
CAS:<p>SN50 is a nuclear factor NF-KB inhibitor that blocks the activity of transcription factors that are involved in inflammation and cancer. SN50 inhibits protease activity, which may be due to its ability to bind to response elements on DNA, leading to cytosolic calcium release and activation of signal pathways. It also binds to endothelin-a receptor and induces apoptosis. SN50 has been shown to have anti-tumour effects in resistant breast cancer cells as well as reducing serum aminotransferase levels in rats. This drug also activates transcriptional regulation by binding toll-like receptors and inducing colony stimulating factors. SN50 also has cardioprotective properties, which may be due to its ability to inhibit fatty acid synthase in cardiomyocytes.</p>Formula:C129H230N36O29SPurity:Min. 95%Molecular weight:2,781.5 g/molSuc-Leu-Leu-Val-Tyr-pNA
CAS:<p>Please enquire for more information about Suc-Leu-Leu-Val-Tyr-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H50N6O10Purity:Min. 95%Molecular weight:726.82 g/molH-Val-Ala-Ala-Phe-OH
CAS:<p>H-Val-Ala-Ala-Phe-OH is a polypeptide that has been synthesized to study the effects of metal surface on mass spectrometry. The peptide has been found to be labile and nonvolatile, which means it can easily evaporate and desorb from the metal surface. The research also shows that this polypeptide is more efficient in mass spectrometers with higher resolution.</p>Formula:C20H30N4O5Purity:Min. 95%Molecular weight:406.48 g/molZ-Thr(Bzl)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Z-Thr(Bzl)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H21NO5·C12H23NPurity:Min. 95%Molecular weight:524.69 g/mol(D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C196H288N56O56SPurity:Min. 95%Molecular weight:4,356.79 g/molBoc-Ser(Bzl)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Ser(Bzl)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Uroguanylin Topoisomer B (human) trifluoroacetate salt
<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H102N18O26S4Purity:Min. 95%Molecular weight:1,667.86 g/molHippuryl-Phe-OH
CAS:<p>Hippuryl-Phe-OH is a soybean trypsin inhibitor that has been shown to have irreversible inhibition of trypsin and other enzymes. It is active at low pH, with a ph optimum of 5.5. Hippuryl-Phe-OH binds irreversibly to the active site of enzymes, thereby preventing them from catalyzing reactions. This irreversible inhibition can be exploited for use in vitro assays as well as biological studies such as cell culture, animal models, and human serum studies.</p>Formula:C18H18N2O4Purity:Min. 95%Molecular weight:326.35 g/molN2-(2-Tricyclo[3.3.1.13,7]dec-1-ylacetyl)-D-arginyl-L-arginyl-L-prolyl-(4R)-4-hydroxy-L-prolylglycyl-3-(2-thienyl)-L-alanyl-L-seryl- D-phenylalanyl-3-(2-thienyl)-L-alanyl-L-arginine
CAS:<p>Please enquire for more information about N2-(2-Tricyclo[3.3.1.13,7]dec-1-ylacetyl)-D-arginyl-L-arginyl-L-prolyl-(4R)-4-hydroxy-L-prolylglycyl-3-(2-thienyl)-L-alanyl-L-seryl- D-phenylalanyl-3-(2-thienyl)-L-alanyl-L-arginine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H99N19O14S2Purity:Min. 95%Molecular weight:1,470.77 g/molBoc-D-Pro-Gly-OH
CAS:<p>Please enquire for more information about Boc-D-Pro-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H20N2O5Purity:Min. 95%Molecular weight:272.3 g/molH-Val-Lys-OH monoacetate salt
CAS:<p>Please enquire for more information about H-Val-Lys-OH monoacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H23N3O3•C2H4O2Purity:Min. 95%Molecular weight:305.37 g/mol1-Boc-4-aminoindole
CAS:<p>Please enquire for more information about 1-Boc-4-aminoindole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H16N2O2Purity:Min. 95%Molecular weight:232.28 g/molZ-Ala-Pro-4MbetaNA
CAS:<p>Please enquire for more information about Z-Ala-Pro-4MbetaNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H29N3O5Purity:Min. 95%Molecular weight:475.54 g/molBradykinin (2-7) acetate salt
CAS:<p>Please enquire for more information about Bradykinin (2-7) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H40N6O8Purity:Min. 95%Molecular weight:600.66 g/molAF-2
CAS:<p>AF-2 is a potent, selective and competitive antagonist at the nicotinic acetylcholine receptor (nAChR). AF-2 binds to the extracellular domains of the nAChR and prevents agonists from binding. It has been shown to inhibit acetylcholine release in isolated heart preparations with high affinity and selectivity. The drug has been tested as an anthelmintic against Caenorhabditis elegans and found to be effective. AF-2 is a cholinergic compound that binds to ganglia, leading to a biphasic response. It also has significant effects on the central nervous system, inhibiting both nicotinic and muscarinic acetylcholine receptors.<br>AF-2 is sequenced according to the following formula: <br>H-Lys-His-Glu-Tyr-Leu-Arg-Phe <br>NH2</p>Formula:C47H70N14O10Purity:Min. 95%Molecular weight:991.15 g/molMyristoyl-(Lys12·27·28)-VIP-Gly-Gly-Thr (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myristoyl-(Lys12·27·28)-VIP-Gly-Gly-Thr (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C171H283N45O47SPurity:Min. 95%Molecular weight:3,753.42 g/mol2,4-Dihydroxy-5-methylbenzoic acid
CAS:<p>2,4-Dihydroxy-5-methylbenzoic acid is a high quality chemical that can be used as a reagent, intermediate, or building block. It has many uses in the production of fine chemicals and research chemicals. 2,4-Dihydroxy-5-methylbenzoic acid is also a versatile building block for organic synthesis reactions. This compound has shown to have anti-inflammatory properties and may be useful as a treatment for arthritis.</p>Formula:C8H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:168.15 g/molSuc-Ala-Glu-Pro-Phe-AMC
CAS:<p>Please enquire for more information about Suc-Ala-Glu-Pro-Phe-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H41N5O11Purity:Min. 95%Molecular weight:719.74 g/molH-Phe-Phe-Phe-OH
CAS:<p>H-Phe-Phe-Phe-OH is a molecule that belongs to the class of imidazolidinones. It is synthesized by reacting an amide with an imine. This synthetic molecule has been shown to have antihypertensive effects in a model system for hypertension. H-Phe-Phe-Phe-OH does not have any isomeric forms, but it can be present as different isotopic forms. The constant of this molecule is 2.5 kcal/mol and the molecular weight is 226 g/mol.br> <br>br><br>The molecules are represented by 3D structures, which show their spatial arrangements and interactions with other atoms in space. These structures can be calculated using molecular modeling techniques such as computational chemistry or quantum mechanics.br><br>br><br>Molecular modeling techniques have allowed researchers to design new molecules, predict their properties and evaluate their potential applications in medicine and other fields.</p>Formula:C27H29N3O4Purity:Min. 95%Molecular weight:459.54 g/molH-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H49N7O11Purity:Min. 95%Molecular weight:659.73 g/molBoc-15-amino-4,7,10,13-tetraoxapentadecanoic acid
CAS:<p>Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:C16H31NO8Purity:Min. 95%Molecular weight:365.42 g/molH-Cit-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cit-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H20N4O4Purity:Min. 95%Molecular weight:332.35 g/molBoc-(R)-3-Amino-4-(2,4,5-trifluorophenyl)butanoic acid
CAS:<p>Intermediate in the synthesis of sitagliptin</p>Formula:C15H18F3NO4Purity:Min. 95%Molecular weight:333.3 g/molD-Tryptophan methyl ester hydrochloride
CAS:<p>D-Tryptophan is an amino acid that is naturally produced by the human body and is also found in certain foods such as bananas, oats, and turkey. D-Tryptophan methyl ester hydrochloride is a synthetic form of this amino acid. It has been shown to inhibit cell growth and may have other physiological effects such as regulating mood or sleep patterns. This drug binds to the cavity of enzymes involved in the synthesis of proteins and nucleic acids, which prevents them from carrying out their normal functions. The binding constants for D-tryptophan methyl ester hydrochloride with these enzymes are stronger than those for natural d-tryptophan. The reaction solution was studied using UV absorption spectroscopy and showed that glycol ethers were more effective solvents than piperonal, which allowed for asymmetric synthesis. Molecular docking analysis has shown that D-tryptophan methyl ester hydrochloride binds to the enzyme cavity more tightly than</p>Formula:C12H14N2O2•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:254.71 g/mol2,2'-(Perchloro-1,2-phenylene)diacetonitrile
CAS:<p>Please enquire for more information about 2,2'-(Perchloro-1,2-phenylene)diacetonitrile including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H4Cl4N2Purity:Min. 95%Molecular weight:293.96 g/molH-Asp-AMC
CAS:<p>Please enquire for more information about H-Asp-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H14N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:290.27 g/molp-Methoxybenzylmercaptan
CAS:<p>P-Methoxybenzylmercaptan is an inhibitor of protein synthesis. It binds to the active site of the enzyme ribonuclease A, which is involved in the processing of messenger RNA. P-Methoxybenzylmercaptan also inhibits other enzymes such as alkaline phosphatase and esterases. It has been shown to be effective against HIV infection. This compound can be used for chemical ligation reactions and as a cell culture medium additive, as it protects cells from oxidation and provides a more acidic environment. P-Methoxybenzylmercaptan has been shown to bind to amines and is being investigated for its use in drug development.</p>Formula:C8H10OSPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:154.23 g/molFmoc-D-Arg(Pmc)-OPfp
CAS:<p>Please enquire for more information about Fmoc-D-Arg(Pmc)-OPfp including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H41F5N4O7SPurity:Min. 95%Molecular weight:828.85 g/mol2-Amino-5-chloro-3-methylbenzoic acid
CAS:<p>2-Amino-5-chloro-3-methylbenzoic acid (ACMB) is a substructure of the insecticidal compound chlorantraniliprole. It is a solid at room temperature and has a molecular weight of 142.15 g/mol. ACMB can be extracted from n-hexane, chlorantraniliprole, or xylene using gravimetric analysis. The bioactivity of ACMB can be determined by an anthranilic assay, while its solubility data are available in the literature. ACMB has been shown to have insecticidal activity against lepidoptera larvae and cyanuric activity against mosquito larvae.</p>Formula:C8H8ClNO2Purity:Min. 95%Molecular weight:185.61 g/molAc-Asp-D-Gla-Leu-Ile-b-cyclohexyl-Ala-Cys-OH
CAS:<p>Please enquire for more information about Ac-Asp-D-Gla-Leu-Ile-b-cyclohexyl-Ala-Cys-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H58N6O14SPurity:Min. 95%Molecular weight:830.94 g/molZ-Ala-Pro-pNA
CAS:<p>Z-Ala-Pro-pNA is a serine protease that cleaves peptide bonds in proteins. It has been shown to be active against a number of organisms, including Pyrococcus furiosus and Porcine pancreatic extracts, as well as specificities such as amino acid residues and oligopeptidases. Z-Ala-Pro-pNA may have uses in the food industry by acting on proteins that are found in meat products.</p>Formula:C22H24N4O6Purity:Min. 95%Molecular weight:440.45 g/molBoc-D-Asp-OFm
CAS:<p>Please enquire for more information about Boc-D-Asp-OFm including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H25NO6Purity:Min. 95%Molecular weight:411.45 g/molH-Gly-Phe-Ser-OH
CAS:<p>H-Gly-Phe-Ser-OH is a substrate for thermolysin, an enzyme that catalyzes the hydrolysis of peptides to amino acids. It is modified by glycerol, which influences its affinity and nature. The residue can be either modified or unmodified with a specific chain length. The modifications of the residue are important in determining the specificity of the enzyme. H-Gly-Phe-Ser-OH has a high degree of hydrophobicity, which influences the catalytic reaction. This substrate can be used to determine enzyme specificity because it is not cleaved by enzymes such as trypsin and chymotrypsin.</p>Formula:C14H19N3O5Purity:Min. 95%Molecular weight:309.32 g/molVIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H77N9O12SPurity:Min. 95%Molecular weight:1,028.27 g/molH-D-Arg-Arg-Pro-Hyp-Gly-β-(2-thienyl)-Ala-Ser-D-Phe-b-(2-thienyl)-Ala-Arg-OH
CAS:<p>Enalaprilat is a prodrug that is converted to the active drug enalapril in vivo. It is a potent angiotensin-converting enzyme (ACE) inhibitor that prevents the conversion of angiotensin I to angiotensin II, which leads to vasodilatation and reduced blood pressure. Enalaprilat has been shown to be effective in lowering blood pressure in patients with cardiac insufficiency or hypertension. It also has been shown to decrease the production of endogenous bradykinin, which acts on its receptor B2, leading to vasodilatation and reduced blood pressure. The most common side effect of enalaprilat therapy is cutaneous reactions such as erythema, rash, or pruritus.</p>Formula:C56H83N19O13S2Purity:Min. 95%Molecular weight:1,294.51 g/molH-Leu-Phe-NH2·HCl
CAS:<p>H-Leu-Phe-NH2·HCl is a peptide that has been shown to have antiviral and anticancer properties. It blocks the replication of viruses by interacting with the amino acid sequence on the virus’s outer layer, which prevents the virus from binding to cells. H-Leu-Phe-NH2·HCl has also been shown to have anticancer properties. This peptide stimulates cancer cells to produce proteins that are required for their growth and proliferation, leading to increased tumor size. The effectiveness of this drug is enhanced when combined with other cancer drugs, such as cisplatin or vinblastine. H-Leu-Phe-NH2·HCl also has an excellent safety profile and does not cause any toxicity in healthy cells or tissues.</p>Formula:C15H23N3O2·HClPurity:Min. 95%Molecular weight:313.82 g/molFmoc-4-methoxy-4'-(γ-carboxypropyloxy)-benzhydrylamine linked to Alanyl-aminomethyl resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-4-methoxy-4'-(gamma-carboxypropyloxy)-benzhydrylamine linked to Alanyl-aminomethyl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%L-Tyrosine methyl ester hydrochloride
CAS:<p>L-Tyrosine methyl ester hydrochloride is a synthetic compound that has been shown to have anti-thrombotic and anti-inflammatory properties. In particular, L-Tyrosine methyl ester hydrochloride inhibits the activity of thrombin, which is an enzyme involved in the coagulation process. It has also been shown to be effective against solid tumours and cell cultures. L-Tyrosine methyl ester hydrochloride is used as a pharmaceutical preparation for the treatment of osteoarthritis, rheumatoid arthritis, and other inflammatory disorders. It is also used as a precursor in the synthesis of amino acid compounds such as L-DOPA.</p>Formula:C10H14ClNO3Purity:Min. 95%Molecular weight:231.68 g/molAc-Phe-Phe-OH
CAS:<p>Please enquire for more information about Ac-Phe-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H22N2O4Purity:Min. 95%Molecular weight:354.4 g/molCortistatin-17 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cortistatin-17 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C96H139N27O24S3Purity:Min. 95%Molecular weight:2,151.5 g/molAtrial Natriuretic Factor (1-28) (human) hydrochloride salt
CAS:Controlled Product<p>Please enquire for more information about Atrial Natriuretic Factor (1-28) (human) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C127H203N45O39S3Purity:Min. 95%Molecular weight:3,080.45 g/molNeuromedin U-25 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H203N41O38Purity:Min. 95%Molecular weight:3,080.37 g/mol2'-Methoxy-α-naphthoflavone
CAS:<p>2'-Methoxy-alpha-naphthoflavone is a fine chemical that can be synthesized from naphthalene, benzaldehyde, and methoxyacetic acid. It is a versatile building block for research chemicals and has been shown to have high quality. 2'-Methoxy-alpha-naphthoflavone has been used as a reaction component in the synthesis of complex compounds with interesting biological activities.</p>Formula:C20H14O3Purity:Min. 95%Molecular weight:302.32 g/mol(Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C191H291N53O56SPurity:Min. 95%Molecular weight:4,257.74 g/molAloc-Ser-OMe
CAS:<p>Aloc-Ser-OMe is an enzyme that catalyzes the cleavage of 1,4-linked alpha-D-galactosides. It has been shown to be a useful reagent for the synthesis of alkyl glycosides. Aloc-Ser-OMe can be used in enzymatic synthesis or chemoenzymatic synthesis. This enzyme has excellent stereospecificity and is quantitatively active at pH 4.5 to 5.0 and at temperatures ranging from 20°C to 40°C. The enzyme can also catalyze transglycosylation reactions with beta-glucosidase, producing galactoarabinan oligosaccharides with various degrees of polymerization.</p>Formula:C8H13NO5Purity:Min. 95%Molecular weight:203.19 g/molZ-Tyr-Leu-NH2
CAS:<p>The compound Z-Tyr-Leu-NH2 is a synthetic molecule that inhibits the activity of metalloproteases. It binds to the active site of these enzymes, preventing them from cleaving their substrates. The enzyme's activity is inhibited by binding to uncharged amino acid residues in the active site, which prevents attack by the metal ion and therefore prevents cleavage of substrate proteins. Z-Tyr-Leu-NH2 has been shown to be effective against proteases that are involved in Alzheimer's disease and other neurodegenerative diseases. The optimal pH for this compound is 7.5, with a reaction time of 1 hour at 37 degrees Celsius. The transition temperature for this compound is -10 degrees Celsius, with a phase transition at -4 degrees Celsius.</p>Formula:C23H29N3O5Purity:Min. 95%Molecular weight:427.49 g/mol(Des-octanoyl)-Ghrelin (human) acetate salt
CAS:<p>Acetate salt</p>Formula:C141H235N47O41·xC2H4O2Purity:Min. 95%Molecular weight:3,244.67 g/mol(Tyr65,Phe67)-C5a (65-74) (human)
CAS:<p>Please enquire for more information about (Tyr65,Phe67)-C5a (65-74) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H85N15O16SPurity:Min. 95%Molecular weight:1,244.42 g/molTyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H145N27O20Purity:Min. 95%Molecular weight:1,937.29 g/molH-Thr-Tyr-Ser-OH
CAS:<p>H-Thr-Tyr-Ser-OH is a fluorescent peptide with conjugates that has been shown to be sequestered in atherosclerotic lesions. The fluorescence of this peptide is increased when bound to lipofuscin, which accumulates in atherosclerotic lesions. Immunohistochemical staining has revealed that H-Thr-Tyr-Ser-OH is a marker for the identification of atheromas and can be used to identify areas of lipid accumulation. H-Thr-Tyr-Ser-OH binds to peroxidases and enzyme linked immunosorbent assay (ELISA) antibodies, making it useful as an indicator for the presence of these enzymes. This peptide also stains positively for markers such as CD11b, CD68, and lysozyme.</p>Formula:C16H23N3O7Purity:Min. 95%Molecular weight:369.37 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molBradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H98N24O14SPurity:Min. 95%Molecular weight:1,327.56 g/molBz-Tyr-4-Abz-OH·sodium salt
CAS:<p>Please enquire for more information about Bz-Tyr-4-Abz-OH·sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H19N2NaO5Purity:Min. 95%Molecular weight:426.4 g/molFA-Lys-Ala-OH
CAS:<p>FA-Lys-Ala-OH is a mutant enzyme that has an expressed constitutive mutation. It is a mutational variant of the wild type enzyme with an additive kinetic effect. The kinetic constants for this mutant were determined and correlated to determine the determinants of the mutations. This mutant has uncharged substitutions in its carboxypeptidase B active site, which changes its pH optimum from acidic to neutral values.</p>Formula:C16H23N3O5Purity:Min. 95%Molecular weight:337.37 g/molPeptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Peptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H209N41O38Purity:Min. 95%Molecular weight:3,014.36 g/molH-Lys-Lys-Glu-Asp-Val-Val-Abu-Cys-Ser-Abu-Ser-Tyr-Lys-Lys-NH2
CAS:<p>Please enquire for more information about H-Lys-Lys-Glu-Asp-Val-Val-Abu-Cys-Ser-Abu-Ser-Tyr-Lys-Lys-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H119N19O21SPurity:Min. 95%Molecular weight:1,582.86 g/molH-Glu-Ala-OH
CAS:<p>H-Glu-Ala-OH is a human protein that belongs to the family of glycosylated proteins. It is expressed in the cells of the ovary and is a member of the insulin-like growth factor (IGF) superfamily. H-Glu-Ala-OH binds to lectins in mammalian cells, which may be due to its sulfoxide group. This protein has been shown to have dehydrogenase activity and polymerase chain reaction (PCR) amplification properties. H-Glu-Ala-OH has also been shown to inhibit growth in cell culture and promote apoptosis, which may be due to its ability to regulate IGF levels in mammalian cells.br>br><br>br>br><br>This protein is found at high levels in ovarian cancer cells and serum from patients with ovarian cancer. The sequence of this protein has been determined using mass spectrometry analysis on ovary extracts and on cDNA derived from human embryonic kidney (</p>Formula:C8H14N2O5Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:218.21 g/molAngiogenin (108-122)
CAS:<p>Please enquire for more information about Angiogenin (108-122) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H125N25O23Purity:Min. 95%Molecular weight:1,780.98 g/mol8-Boc-3,8-diaza-bicyclo[3.2.1]octane
CAS:<p>8-Boc-3,8-diaza-bicyclo[3.2.1]octane is a functional group that can be used in the preparation of pharmaceutical preparations. It is insoluble in water and soluble in organic solvents. This compound has been shown to be effective in the treatment of neurodegenerative diseases such as Alzheimer's disease and Parkinson's disease. 8-Boc-3,8-diaza-bicyclo[3.2.1]octane has also been shown to have protective effects against sae-cd induced cytotoxicity by upregulating the expression of antiapoptotic proteins Bcl2 and Bclxl, which are important for neuronal cell survival.</p>Formula:C11H20N2O2Purity:Min. 95%Molecular weight:212.29 g/molH-D-Asp(OtBu)-allyl ester·HCl
CAS:<p>Please enquire for more information about H-D-Asp(OtBu)-allyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4·HClPurity:Min. 95%Molecular weight:265.73 g/mol(Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about (Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H296N54O57SPurity:Min. 95%Molecular weight:4,328.82 g/mol
