
GPCR/G-Protein
GPCR/G-Protein inhibitors are compounds that target G-protein coupled receptors (GPCRs) and associated G-proteins, which play critical roles in transmitting signals from the outside to the inside of cells. These inhibitors are essential for studying the signaling pathways mediated by GPCRs, which are involved in numerous physiological processes, including sensory perception, immune response, and neurotransmission. GPCR inhibitors are also important in drug development, as many therapeutic agents target these receptors. At CymitQuimica, we offer a wide range of high-quality GPCR/G-Protein inhibitors to support your research in pharmacology, cell biology, and related fields.
Subcategories of "GPCR/G-Protein"
- 5-HT Receptor(942 products)
- Adenosine Receptor(242 products)
- Adrenergic Receptor(2,949 products)
- Bombesin Receptor(30 products)
- Bradykinin Receptor(59 products)
- CXCR(149 products)
- CaSR(32 products)
- Cannabinoid Receptor(195 products)
- Dopamine Receptor(410 products)
- Endothelin Receptor(75 products)
- GNRH Receptor(73 products)
- GPCR19(31 products)
- GRK(32 products)
- GTPase(21 products)
- Glucagon Receptor(166 products)
- Hedgehog/Smoothened(45 products)
- Histamine Receptor(359 products)
- LPA Receptor(21 products)
- Melatonin Receptor(24 products)
- OX Receptor(40 products)
- Opioid Receptor(298 products)
- PAFR(11 products)
- PKA(49 products)
- S1P Receptor(17 products)
- SGLT(30 products)
- Sigma receptor(46 products)
Show 18 more subcategories
Found 5378 products of "GPCR/G-Protein"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
MrgprX2 antagonist-5
CAS:<p>MrgprX2 antagonist-5 from patent WO2020223255A1 inhibits MrgprX2, useful for inflammatory skin disorder studies.</p>Formula:C19H13ClF2N4O2SColor and Shape:SolidMolecular weight:434.85S1H
<p>S1H is an analog of human growth hormone (hGH) and acts as an antagonist to the human growth hormone receptor (hGHR). It inhibits the interaction between hGH and hGHR and prevents the phosphorylation of STAT5 in cells treated with hGH.</p>Formula:C94H141N23O27Molecular weight:2024.03673Dopamine D2 receptor agonist-2
CAS:<p>Dopamine D2 receptor agonist-2 (Dopamine D2 Receptor) is a ligand targeting the dopamine D2 receptor.</p>Formula:C25H31Cl2N5OSPurity:98.93%Color and Shape:SoildMolecular weight:520.52Azido-FTY720
CAS:<p>Azido-FTY720 (azido-Fingolimod) is an analogue of FTY720, with an azido group for click chemistry reactions. FTY720 is an orally available S1P1R modulator .</p>Formula:C19H32N4O2Color and Shape:SolidMolecular weight:348.49IRL-1038
CAS:<p>ETB endothelin receptor antagonist</p>Formula:C68H92N14O15S2Purity:98%Color and Shape:SolidMolecular weight:1409.67Prazobind
CAS:<p>Prazobind is a prazosinoid substance that blocks insulin stimulation of IP1 (inositol phosphate) accumulation and is an effective α1 adrenoceptor blocker.</p>Formula:C23H27N5O3Color and Shape:SolidMolecular weight:421.501NF546
CAS:<p>NF546 is a selective agonist of non-nucleotide P2Y11(pEC50 of 6.27).</p>Formula:C47H44N6Na4O17P4Purity:98%Color and Shape:SolidMolecular weight:1180.74Nebokitug
<p>Nebokitug is a humanized IgG1κ antibody targeting CCL24, with HumanIgG1kappa, Isotype Control serving as its corresponding isotype control.</p>Color and Shape:Odour LiquidCortagine
<p>Potent CRF1 agonist, EC50 = 0.18 nM in rats. Exhibits in vivo anxiolytic and antidepressant effects; reduces mouse defensive behavior.</p>Formula:C192H323N55O63SPurity:98%Color and Shape:SolidMolecular weight:4442.06Nafetolol
CAS:<p>Nafetolol (K 5407) is a biochemical reagent that can be used to synthesize other compounds.</p>Formula:C19H29NO3Purity:98.91%Color and Shape:SolidMolecular weight:319.44Abediterol napadisylate
CAS:<p>Abediterol napadisylate is a novel long-acting β2-agonist in persistent asthma that is efficacy, safe, and tolerable.</p>Formula:C60H68F4N4O14S2Purity:98%Color and Shape:SolidMolecular weight:1209.32Vapiprost
CAS:<p>Vapiprost is an antagonist of the thromboxane receptor and a prostaglandin receptor.</p>Formula:C30H39NO4Purity:98%Color and Shape:SolidMolecular weight:477.64K41498
CAS:<p>Potent CRF2α/β antagonist; Ki: 0.66/0.62 nM, weak for CRF1 (425 nM). Blocks sauvagine in hCRF2 cells and urocortin hypotension in rats.</p>Formula:C162H276N48O46Purity:98%Color and Shape:SolidMolecular weight:3632.26α-MSH acetate
<p>α-MSH acetate is an endogenous neuromodulatory peptide derived from POMC and an agonist of MC4R (melanocortin receptor 4).</p>Purity:99.71%Color and Shape:Odour SolidPSB-22269
<p>PSB-22269 is identified as a GPR17 antagonist with a Ki value of 8.91 nM. It exhibits significant inhibitory effects in cAMP and G protein activation assays. Molecular docking studies indicate that the binding site of PSB-22269 includes positively charged arginine residues and a hydrophobic pocket. PSB-22269 promotes myelin regeneration strategies, offering potential for multiple sclerosis research.</p>Formula:C26H21NO6Color and Shape:SolidMolecular weight:443.45L 366811
CAS:<p>L 366811 is a potent oxytocin antagonist.</p>Formula:C43H56N8O6Color and Shape:SolidMolecular weight:780.95Albiglutide Fragment
CAS:<p>Albiglutide fragment is a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36).</p>Formula:C148H224N40O45Purity:98%Color and Shape:SolidMolecular weight:3283.6[cPP1-7,NPY19-23,Ala31,Aib32,Gln34]-hPancreatic Polypeptide
CAS:<p>Potent, selective NPY Y5 receptor agonist; IC50: 0.24 nM (Y5), >500 nM (Y2), 530 nM (Y1), 51 nM (Y4); Ki: 0.1-0.15 nM (Y5); increases food intake in vivo.</p>Formula:C183H281N57O54S2Purity:98%Color and Shape:SolidMolecular weight:4207.67Acrinor
CAS:<p>Acrinor is a adrenergic beta receptor agonist.</p>Formula:C35H46Cl2N10O8Purity:98%Color and Shape:SolidMolecular weight:805.72ADTN
CAS:<p>ADTN is an agonist of the dopamine receptor.</p>Formula:C10H13NO2Purity:98%Color and Shape:SolidMolecular weight:179.22VU0453379
CAS:<p>VU0453379 is a highly selective and central nervous system penetrant positive allosteric modulator of glucagon-like peptide-1R (EC50: 1.3 μM).</p>Formula:C26H34N4O2Purity:98%Color and Shape:SolidMolecular weight:434.57FR190997
CAS:<p>FR190997 is an agonist of bradykinin B2 receptor.</p>Formula:C37H33Cl2N5O5Color and Shape:SolidMolecular weight:698.59TGR5 agonist 6
CAS:<p>Compound 22b, also known as TGR5 agonist 6, is a non-systemic, intestine-targeted TGR5 agonist that demonstrates significant and sustained blood glucose-lowering effects with an acceptable safety profile.</p>Formula:C42H48Cl2N6O6Color and Shape:SolidMolecular weight:803.77GLP-1R Antagonist 1
CAS:<p>GLP-1R Antagonist 1 is an orally active, CNS penetrant and non-competitive glucagon-like peptide 1 receptor (GLP-1R) antagonist (IC50: 650 nM).</p>Formula:C16H11ClF6N4O2Purity:99.84%Color and Shape:SolidMolecular weight:440.73INCB3344 R-isomer
<p>INCB3344 is a potent CCR2 antagonist. INCB3344 R-isomer is the R-isomer of INCB3344.</p>Formula:C29H34F3N3O6Purity:98%Color and Shape:SolidMolecular weight:577.59Metaraminol
CAS:<p>Metaraminol is a sympathomimetic agent that acts predominantly at alpha-1 adrenergic receptors.</p>Formula:C9H13NO2Color and Shape:SolidMolecular weight:167.21Cagrilintide acetate
<p>.Cagrilintide is a long-acting amylin analog,treat diabetes and obesity by reducing appetite through activation of the AMY3R and calcitonin receptor.</p>Formula:C196H316N54O61S2Purity:99.88%Color and Shape:SolidMolecular weight:4469.06Hemokinin 1, human
CAS:Endogenous P-like compound, NK1 receptor agonist; IC50: NK1-1.8 nM, NK3-370 nM, NK2-480 nM; boosts B-cell growth, antiapoptotic, lowers blood pressure in vivo.Formula:C54H84N14O14SPurity:98%Color and Shape:SolidMolecular weight:1185.42-Furoyl-LIGRLO-amide
CAS:<p>2-Furoyl-LIGRLO-amide TFA is a peptide that acts as a proteinase-activated receptor-2 (PAR2) agonist, and contains a furoyl group addition at its N-terminal.</p>Formula:C36H63N11O8Purity:98%Color and Shape:SolidMolecular weight:777.95Hemokinin 1 (mouse)
CAS:<p>Hemokinin 1 (mouse) is a selective excitogen 1 receptor agonist with a Ki value of 0.175 nM for the human NK1 receptor and 560 nM for the human NK2 receptor.</p>Formula:C61H100N22O15SPurity:98%Color and Shape:White PowderMolecular weight:1413.65Clotizolam
CAS:<p>Clotizolam is a thienotriazolodiazepine derivative with PAF antagonistic properties, exhibiting sedative, anxiolytic, anticonvulsant, and muscle relaxant effects.</p>Formula:C15H10Cl2N4SColor and Shape:SolidMolecular weight:349.24Ro 25-1553
CAS:<p>Ro 25-1553 is a 31-amino acid analog of vasoactive intestinal peptide (VIP) that functions as an agonist for the VIP2 receptor (VPAC2 receptor). In guinea pig models, Ro 25-1553 exhibits bronchodilator effects on tracheal smooth muscle contraction induced by neural stimuli or Carbachol.</p>Formula:C160H258N46O46Color and Shape:SolidMolecular weight:3562.04Detomidine carboxylic acid
CAS:<p>Detomidine carboxylic acid, a urine metabolite of detomidine, is a synthetic α2-agonist, animal analgesic, with cardiac, respiratory, and diuretic effects.</p>Formula:C12H12N2O2Purity:98%Color and Shape:SolidMolecular weight:216.24O-2172
CAS:<p>O-2172 is a carbocyclic analogue serving as an inhibitor of dopamine transporter (DAT), exhibiting IC50 values of 47 nM for DAT and 7000 nM for the serotonin transporter (SERT).</p>Formula:C14H16Cl2O2Color and Shape:SolidMolecular weight:287.18P2Y14 antagonist 1
<p>P2Y14 antagonist 1 (compound 45) is a highly selective and orally active P2Y14 receptor antagonist with an IC50 value of 0.70 nM. It demonstrates significant anti-inflammatory effects by effectively reducing pulmonary infiltration of immune cells and inflammatory responses through the inhibition of the NLRP3 signaling pathway. P2Y14 antagonist 1 is suitable for studying acute lung injury.</p>Formula:C24H21N3O3Color and Shape:SolidMolecular weight:399.4425-hydroxy Propranolol
CAS:<p>5-hydroxy Propranolol, a propranolol metabolite, is formed in the liver via P450 2D6.</p>Formula:C16H21NO3Color and Shape:SolidMolecular weight:275.348Apigenin 6,8-di-C-α-L-arabinopyranoside
CAS:<p>Apigenin 6,8-di-C-alpha-L-arabinopyranoside is a useful organic compound for research related to life sciences.</p>Formula:C25H26O13Color and Shape:SolidMolecular weight:534.47Thiothixene
CAS:<p>Thiothixene has a wide range of applications in life science related research.</p>Formula:C23H29N3O2S2Color and Shape:SolidMolecular weight:443.62Neuropeptide Y (human)
CAS:<p>Neuropeptide Y (29-64), amide, human is a biologically active 36-amino acid peptide.</p>Formula:C189H285N55O57SPurity:98%Color and Shape:SolidMolecular weight:4271.68AR-C126313
CAS:<p>AR-C126313 is a thiouracil derivative.</p>Formula:C28H23N7O3SColor and Shape:SolidMolecular weight:537.59[Ala1,3,11,15]-Endothelin
CAS:<p>Selective ETB endothelin receptor agonist (IC50 values are 0.33 and 2200 nM for displacing [125I]-ET-1 from ETB and ETA receptors respectively).</p>Formula:C109H163N25O32SPurity:98%Color and Shape:SolidMolecular weight:2368Survodutide
CAS:<p>Survodutide (BI 456906) is a dual agonist of glucagon and glucagon-like peptide 1 (GLP-1) receptor (GLP Receptor) that reduces body weight in HbA1c16 diabetes.</p>Formula:C192H289N47O61Purity:99.83%Color and Shape:SolidMolecular weight:4229.0957Upidosin
CAS:<p>Upidosin (SB-216469), a uroselective α1 blocker: Ki α1a=0.34 nM, α1b=3.9 nM, α1d=1.5 nM, α2=33.3 nM.</p>Formula:C31H33N3O4Purity:99.66%Color and Shape:SolidMolecular weight:511.61Gemeprost
CAS:<p>Gemeprost treats obstetric bleeding and induces abortion up to 24 weeks when used with mifepristone.</p>Formula:C23H38O5Purity:98%Color and Shape:SolidMolecular weight:394.54Mini Gastrin I, human
CAS:<p>Mini Gastrin I, human, is a truncated form of the human gastrin peptide, encompassing amino acids 5-17 of the original sequence.</p>Formula:C74H99N15O26SPurity:98%Color and Shape:SolidMolecular weight:1646.73SRA880 malonate
CAS:<p>SRA880: non-peptide sst(1) antagonist, low affinity for other sst receptors, binds dopamine D4, boosts SRIF, antidepressant-like effects.</p>Formula:C29H36N4O8Purity:98%Color and Shape:SolidMolecular weight:568.62CH-0076989
CAS:<p>CH-0076989 is a chemokine receptor CCR3 agonist.</p>Formula:C24H22Br2N2O2Color and Shape:SolidMolecular weight:530.25Prosaptide TX14(A)
CAS:<p>GPR37L1/GPR37 agonist with EC50 of 5/7 nM, activates G proteins, enhances ERK, myelin synthesis, neuro/glioprotection.</p>Formula:C69H110N16O26Purity:98%Color and Shape:SolidMolecular weight:1579.7216-phenoxy tetranor Prostaglandin F2α methyl ester
CAS:<p>Prostaglandin F2α (PGF2α) drives luteolysis and smooth muscle contraction by activating the FP receptor.</p>Formula:C23H32O6Color and Shape:SolidMolecular weight:404.503Fpl 14294
CAS:<p>Fpl 14294 is a novel CCK-8 agonist with effective intranasal anorectic activity in the rat.</p>Formula:C45H56N8O13S3Purity:98%Color and Shape:SolidMolecular weight:1013.17Levitide
CAS:<p>Levitide is a neurohormone-like peptide which is from the skin of Xenopus laevis.</p>Formula:C66H119N21O19SPurity:98%Color and Shape:SolidMolecular weight:1542.85Velmupressin acetate
CAS:<p>Potent, selective, short-acting peptidic V2R agonist; EC50: 0.07 nM (hV2R), 0.02 nM (rV2R).</p>Formula:C44H64ClN11O10S2Purity:98%Color and Shape:SolidMolecular weight:1006.63Colulintide
CAS:<p>Colulintide is an analog of amylin, utilized in obesity research.</p>Color and Shape:SolidFlunarizine
CAS:<p>Flunarizine is an orally administered peripheral vasodilator, a dual blocker of voltage-gated Na+/Ca2+ channels and a D2 dopamine receptor antagonist.</p>Formula:C26H26F2N2Purity:99.9%Color and Shape:SolidMolecular weight:404.50Eletriptan
CAS:<p>Eletriptan, second-generation triptans used to treat migraines, is used as an abortion drug.</p>Formula:C22H26N2O2SColor and Shape:SolidMolecular weight:382.52S(-)-Bisoprolol fumarate
CAS:<p>S(-)-Bisoprolol fumarate is a selective β1-blocker for hypertension and heart research.</p>Formula:C18H31NO4·xC4H4O4Color and Shape:SolidMolecular weight:441.521Galanin (1-19), human
CAS:<p>Galanin (1-19), human: a fragment of GAL neuropeptide influencing hormone release, pain response, and eating behavior.</p>Formula:C89H130N26O25Purity:98%Color and Shape:SolidMolecular weight:1964.14Besipirdine hydrochloride
CAS:<p>Besipirdine hydrochloride is a non-receptor-dependent cholinomimetic compound with cardiovascular activity that inhibits the uptake of biogenic amines.</p>Formula:C16H18ClN3Purity:98.45%Color and Shape:SoildMolecular weight:287.79Mirtazapine N-oxide
CAS:<p>Mirtazapine N-oxide, a mirtazapine metabolite, is produced by CYP1A2 and CYP3A4 in human liver.</p>Formula:C17H19N3OColor and Shape:SolidMolecular weight:281.359SRI-37330
CAS:<p>SRI-37330 inhibits glucagon secretion and function, reduces hepatic glucose production, and reverses hepatic steatosis.</p>Formula:C16H19F3N4O2SPurity:99.65%Color and Shape:SolidMolecular weight:388.41MI 1544
CAS:<p>MI 1544 is a LHRH antagonist.</p>Formula:C71H94ClN17O13Color and Shape:SolidMolecular weight:1429.09(R)-Zevaquenabant
<p>(R)-Zevaquenabant ((R)-MRI-1867) is the enantiomer of Zevaquenabant. Zevaquenabant ((S)-MRI-1867) is a peripherally restricted, orally bioavailable dual antagonist of the cannabinoid CB1 receptor and inducible nitric oxide synthase (iNOS). It is beneficial in improving chronic kidney disease (CKD) caused by obesity.</p>Color and Shape:Odour SolidFasitibant chloride hydrochloride
CAS:Fasitibant chloride( MEN16132) is an effective and selective non-peptide antagonist of kinin B2 receptor.Formula:C36H50Cl4N6O6SColor and Shape:SolidMolecular weight:836.7DOTA-EB-TATE
DOTA-EB-TATE is formed by combining the SST peptide derivative DOTA-octreotate with an Evans blue analog (EB). This peptide drug conjugate (PDC) enhances the pharmacokinetics of SSTR2 analogs and reduces PRRT toxicity. Additionally, DOTA-EB-TATE serves in the synthesis/research of radiopharmaceutical conjugates (RDC).Formula:C105H133N21O30S5Molecular weight:2329.63tcY-NH2
CAS:<p>Selective PAR4 antagonist peptide. Inhibits endostatin release and platelet aggregation induced by thrombin.</p>Formula:C40H49N7O7Purity:98%Color and Shape:SolidMolecular weight:739.87Alsactide
CAS:<p>Alsactide, an adrenocorticotropic hormone (ACTH) agonist and a heptadecapeptide analogue, is utilized in the study of the central nervous system [1].</p>Formula:C99H155N29O21SColor and Shape:SolidMolecular weight:2119.53M1145
CAS:<p>Potent GAL2 agonist with EC50 = 38 nM; Ki: 6.55 nM (GAL2), 497 nM (GAL3), 587 nM (GAL1); enhances galanin signaling.</p>Formula:C128H205N37O32Purity:98%Color and Shape:SolidMolecular weight:2774.26[D-Trp8,Tyr11] Somatostatin
CAS:[D-Trp8,Tyr11] Somatostatin, an analogue of the hormone somatostatin that modulates numerous bodily functions, is characterized by the substitution of DTrp8,Formula:C76H104N18O20S2Molecular weight:1653.88PACAP (1-38) free acid TFA
<p>PACAP (1-38) free acid TFA, an endogenous neuropeptide, effectively enhances antral motility and somatostatin secretion, while concurrently suppressing gastrin</p>Color and Shape:Odour SolidELA-32(human)
CAS:<p>Potent apelin receptor agonist with IC50 = 0.27 nM; does not bind GPR15/GPR25. Boosts hESC self-renewal and angiogenesis.</p>Formula:C170H289N63O39S4Purity:98%Color and Shape:SolidMolecular weight:3967.8FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Color and Shape:SolidMolecular weight:3692.15Onvitrelin ucalontide
CAS:Onvitrelin ucalontide is a LHRH analogue with anticancer effect; halts breast, ovarian, and prostate tumors in mice.Formula:C163H243N43O32Molecular weight:3316.94TAK-683 acetate
<p>TAK-683 acetate: potent KISS1R agonist (IC50=170 pM), stable, nonapeptide. Affects GnRH, FSH, LH, testosterone; potential in prostate cancer research.</p>Formula:C66H87N17O15Color and Shape:SolidMolecular weight:1358.5Linaclotide acetate
CAS:<p>Linaclotide acetate, an oral guanylate cyclase C agonist with 14 amino acids, treats constipation-predominant IBS and chronic constipation.</p>Formula:C61H83N15O23S6Purity:98%Color and Shape:SolidMolecular weight:1586.79WAY-639418
CAS:<p>WAY-639418 has potential anti-inflammatory and anti-HIV activity and can be used to study CCR5-mediated inflammatory and immunomodulatory diseases.</p>Formula:C17H16ClN5Purity:99.62%Color and Shape:SolidMolecular weight:325.8PY-60
CAS:<p>PY-60 can effectively activate YAP transcriptional activity against annexin A2 (ANXA2).Cost-effective and quality-assured.</p>Formula:C16H15N3O2SPurity:99.5% - 99.67%Color and Shape:SolidMolecular weight:313.37AZ7976
CAS:<p>AZ7976 (Compound 42), a potent and highly selective agonist for Relaxin Family Peptide Receptor 1 (RXFP1) with a pEC 50 value greater than 10.5, operates through an allosteric mechanism to enhance RXFP1's cAMP signaling, which physiologically elevates heart rate. This property makes AZ7976 a valuable tool in cardiovascular disease research [1].</p>Formula:C30H33F7N2O6SColor and Shape:SolidMolecular weight:682.65γ-1-Melanocyte Stimulating Hormone (MSH), amide
<p>γ-1-Melanocyte Stimulating Hormone (MSH), amide, a peptide consisting of 11 amino acids, plays a critical role in regulating sodium (Na+) balance and blood</p>Formula:C72H97N21O14SColor and Shape:SolidMolecular weight:1512.9SR142948A
CAS:<p>SR142948A is a selective and reversible non-peptide neurotensin receptor antagonist blocking hypothermia and analgesic effects, NMDA-induced dopamine release.</p>Formula:C39H52ClN5O6Purity:98%Color and Shape:SolidMolecular weight:722.31[bAla8]-Neurokinin A(4-10)
CAS:[bAla8]-Neurokinin A(4-10) is a neurokinin 2 (NK2) receptor agonist.Formula:C35H56N8O10SPurity:98%Color and Shape:SolidMolecular weight:780.94ECPLA
CAS:<p>ECPLA is an LSD analog and a potent 5-HT2A agonist (EC50 of 14.6 nM), capable of stimulating Gq-mediated calcium flux. It exhibits high affinity for most serotonin receptors, α2-adrenergic receptors, and D2-like dopamine receptors.</p>Formula:C21H25N3OColor and Shape:SolidMolecular weight:335.44Cloprostenol isopropyl ester
CAS:<p>(+)-Chloprostol is a PGF2α agonist, mimics prostaglandin F2α, induces luteal dissolution in mares without side effects or stress.</p>Formula:C25H35ClO6Color and Shape:SolidMolecular weight:466.99Baloncibart
CAS:<p>Baloncibart is a human IgG4K monoclonal antibody that targets NPR1.</p>Color and Shape:LiquidNeuropeptide Y (18-36) (porcine)
CAS:<p>"Neuropeptide Y (18-36) (porcine) is a NPY heart receptor blocker, halts I-NPY binding, aids in heart failure research."</p>Formula:C112H174N36O27Color and Shape:SolidMolecular weight:2456.8Utreglutide
CAS:<p>Utreglutide is a potent glucagon-like peptide 1 (GLP-1) receptor agonit [1] .</p>Formula:C191H298N46O58Color and Shape:SolidMolecular weight:4166.67Substance P (4-11)
CAS:Substance P (4-11), a C-terminal fragment of Substance P, acts as a highly selective agonist for NK1 receptors, demonstrating specificity in its interaction.Formula:C46H67N11O10SColor and Shape:SolidMolecular weight:966.16Syk Inhibitor II hydrochloride
CAS:<p>Syk signaling is key in lupus. Syk inhibitors reduce inflammation and sepsis severity in FcgRIIb-/- mice, lowering cytokines and organ damage.</p>Formula:C14H16ClF3N6OPurity:99.05%Color and Shape:SolidMolecular weight:376.778-iso-15-keto Prostaglandin F2α
CAS:<p>8-iso-15-keto Prostaglandin F2α (8-iso-15-keto PGF2α) is a metabolite of the isoprostane 8-iso PGF2α in rabbits, monkeys, and humans.</p>Formula:C20H32O5Color and Shape:SolidMolecular weight:352.471M871
CAS:<p>GAL2 receptor antagonist; Ki: 13.1 nM (GAL2), 420 nM (GAL1); inhibits GAL2-induced pain.</p>Formula:C108H163N27O28Purity:98%Color and Shape:SolidMolecular weight:2287.64MLGFFQQPKPR-NH2
CAS:<p>MLGFFQQPKPR-NH2 is a reversed Substance P peptide. Substance P is a neuropeptide [1] .</p>Formula:C63H98N18O13SColor and Shape:SolidMolecular weight:1347.63ALD1613
<p>ALD1613 is a potent neutralizing monoclonal antibody targeting adrenocorticotropic hormone (ACTH). It neutralizes ACTH-induced signaling and inhibits cyclic adenosine monophosphate accumulation in ACTH-stimulated Y1 (mouse adrenal cell line) via all five melanocortin receptors. ALD1613 significantly reduces plasma corticosterone levels in wild-type rats and is applicable in studies involving elevated ACTH-related conditions.</p>Color and Shape:Odour LiquidGalanin (1-30), human
CAS:Galanin (1-30), human is a neuropeptide agonist for GalR1/R2 receptors with 1 nM affinity, influencing endocrine, metabolism, and neurotransmission.Formula:C139H210N42O43Purity:98%Color and Shape:SolidMolecular weight:3157.46K-(D-1-Nal)-FwLL-NH2 TFA
<p>K-(D-1-Nal)-FwLL-NH2 TFA: potent ghrelin inverse agonist; Ki=4.9 nM (COS7), 31 nM (HEK293T); blocks Gq/G13 signaling.</p>Formula:C53H68F3N9O8Color and Shape:SolidMolecular weight:1016.16JNJ-10181457 (hydrochloride)
CAS:<p>JNJ-10181457 (hydrochloride) is a non-imidazole H3 receptor antagonist that is brain-penetrating and selective, increasing NE and acetylcholine concentrations</p>Formula:C20H30Cl2N2OColor and Shape:SolidMolecular weight:385.37SB-206606
CAS:<p>SB-206606 is a novel, highly specific radioactive ligand for the β3-adrenergic receptor.</p>Formula:C19H22ClNO4Color and Shape:SolidMolecular weight:363.83Ecnoglutide
CAS:<p>Ecnoglutide (XW003) is a glucagon-like peptide 1 (GLP-1) receptor agonist [1] .</p>Formula:C194H304N48O61Color and Shape:SolidMolecular weight:4284.76ANQ-11125 TFA
<p>ANQ-11125 TFA is a motilin antagonist with a pKd of 8.24, inhibiting motilide contractions in rabbits.</p>Formula:C88H126F3N19O23Color and Shape:SolidMolecular weight:1875.05GLP-1(9-36)amide TFA
<p>GLP-1(9-36)amide TFA, a DPP-4 metabolite of GLP-1(7-36) amide, antagonizes human pancreatic GLP-1 receptor.</p>Formula:C142H215F3N36O45Color and Shape:SolidMolecular weight:3203.43Corazonin
CAS:<p>Corazonin, a neuropeptide in insects, regulates caste identity and behavior, mainly in workers/foragers.</p>Formula:C62H83N17O19Color and Shape:SolidMolecular weight:1370.42GHRF, porcine
CAS:<p>GHRF, porcine, a growth hormone releasing factor (GHRF) peptide (porcine), binds to the growth hormone secretagogue receptor (GHSR), thereby inducing the</p>Formula:C219H365N73O66SColor and Shape:SolidMolecular weight:5108.76dCNP
<p>dCNP binds to NPR-B/C receptors (NPR-B/C receptor), initiating the cGMP signaling pathway and regulating vascular function. It exhibits anti-hypoxic effects by downregulating hypoxia-related genes such as HIF1α and HIF2α. Additionally, dCNP inhibits tumor stroma induction, demonstrating antifibrotic properties. It also enhances immune response by upregulating CTL, NK cells, and conventional type 1 dendritic cells in tumors.</p>Formula:C141H248N38O36S3Color and Shape:SolidMolecular weight:3147.91[Nle11]-Substance P
CAS:<p>'[Nle11]-Substance P is a gut and brain peptide, resisting methionine oxidation and causing excitatory neural effects.'</p>Formula:C64H100N18O13Purity:98%Color and Shape:SolidMolecular weight:1329.59NI-203
<p>NI-203 is a monoclonal antibody inhibitor that targets amylin and shows potential for research in type 2 diabetes.</p>Color and Shape:Odour LiquidPG106 TFA
<p>PG106 TFA is a potent hMC3 antagonist (IC50=210 nM), inactive at hMC4 (EC50=9900 nM) and hMC5 receptors.</p>Formula:C53H70F3N13O11Color and Shape:SolidMolecular weight:1122.2Human growth hormone-releasing factor TFA
<p>Human growth hormone-releasing factor TFA is a hypothalamic peptide that promotes GH secretion by targeting pituitary GHRHR.</p>Formula:C217H359F3N72O68SColor and Shape:SolidMolecular weight:5153.67NSC380324
<p>NSC380324 is a P2Y12 receptor antagonist with antiplatelet properties, which can be employed in research on atherosclerotic cardiovascular diseases.</p>Formula:C31H24N4O4Color and Shape:SolidMolecular weight:516.55Paynantheine
CAS:<p>Paynantheine is an alkaloid with antinociceptive properties, found in Mitragyna speciosa. It also acts as an agonist at 5-HT1AR and 5-HT2BR receptors, inducing lower lip contraction and providing antinociception in rats.</p>Formula:C23H28N2O4Color and Shape:SolidMolecular weight:396.48Adrenomedullin (11-50), rat
CAS:Adrenomedullin 11-50 rat is a peptide, stimulates CGRP1 receptor for vasodilation, used in bone growth research.Formula:C194H304N58O59S4Purity:98%Color and Shape:SolidMolecular weight:4521.175-HT1AR/5-HT6R ligand-1
<p>5-HT1AR/5-HT6R ligand-1 (Compound PP13) functions as a ligand for the 5-HT receptor, demonstrating high affinity for 5-HT1AR, 5-HT6R, and 5-HT7R with Ki values of 19, 69, and 198 nM, respectively. In HEK293 cells, it inhibits cAMP production with EC50 values of 1535, 488, and 53 nM for these receptors. Additionally, 5-HT1AR/5-HT6R ligand-1 exhibits antiproliferative effects on several cancer cell lines, including 1321N1, U87MG, MCF7, and AsPC-1, with IC50 values of 9.6, 13.6, 19.3, and 14.6 μM, respectively. The compound also shows antagonistic activity towards the dopamine receptor D2R, with a Ki of 1903 nM.</p>Formula:C25H29ClN4O2SColor and Shape:SolidMolecular weight:485.04A6770
CAS:<p>A6770 inhibits S1P lyase, causing [3H]dhS1P build-up in IT-79MTNC3 cells (EC50 <0.01 μM); less effective with vitamin B6 (EC50 <100 μM).</p>Formula:C6H8N2O2Color and Shape:SolidMolecular weight:140.142Urotensin I
CAS:Urotensin I, 41-aa neuropeptide, agonist for human/rat CRF receptors, lowers blood pressure in rats, isolated from white suckers.Formula:C210H340N62O67S2Purity:98%Color and Shape:SolidMolecular weight:4869.46WS 9326A
CAS:<p>WS 9326A is an antagonist of tachykinin receptor from Streptomyces violaceusniger.</p>Formula:C54H68N8O13Purity:98%Color and Shape:SolidMolecular weight:1037.181Neuropeptide W-30 (rat)
CAS:<p>Neuropeptide W-30 (rat) acts as a crucial stress mediator within the central nervous system, influencing the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. It serves as an endogenous ligand for the two related orphan G-protein-coupled receptors (GPCRs), GPR7 and GPR8. NPW-30 binds and activates both GPR7 and GPR8 at comparable effective doses [1] [2] [3].</p>Formula:C165H249N49O38SColor and Shape:SolidMolecular weight:3559.11CCR8 antagonist 1
CAS:<p>CCR8 antagonist 1 is an antagonist of C-C Motif Chemokine Receptor 8 (CCR8) with a Ki value of 1.6 nM.</p>Formula:C26H29N3O5SPurity:99.51%Color and Shape:SolidMolecular weight:495.59PF-232798
CAS:<p>PF-232798 is a second generation oral CCR5 antagonist with potent broad-spectrum anti-HIV-1 activity.</p>Formula:C29H40FN5O2Color and Shape:SolidMolecular weight:509.66PROTAC(H-PGDS)-8
CAS:<p>PROTAC(H-PGDS)-8 is a PROTAC degrader targeting Hematopoietic prostaglandin D synthase (H-PGDS), exhibiting an IC50 of 0.14 μM [1].</p>Formula:C41H40N8O7Color and Shape:SolidMolecular weight:756.81(-)-Eseroline fumarate
CAS:<p>(-)-Eseroline fumarate, a Physostigmine metabolite and AChE inhibitor, triggers cancer cell LDH release and neuronal cell death.</p>Formula:C17H22N2O5Color and Shape:SolidMolecular weight:334.37MGV354
<p>MGV354 is a soluble activator of guanylate cyclase(sGC) with EC 50 s of <0.5 nM, and 5 nM in CHO and GTM-3 E cells, respectively [1] [2].</p>Formula:C35H37N5O3Purity:98%Color and Shape:SolidMolecular weight:575.7GS-2278
CAS:<p>GS-2278 is an antagonist of LPAR1 (lysophosphatidic acid receptor 1) with potential applications in the study of idiopathic pulmonary fibrosis (IPF).</p>Formula:C22H16F5N9O3Color and Shape:SolidMolecular weight:549.41L-797,591
CAS:<p>L-797,591 is a selective agonist of somatostatin receptor subtype 1.</p>Formula:C38H49N5O2Color and Shape:SolidMolecular weight:607.839-deoxy-9-methylene Prostaglandin E2
CAS:<p>9-deoxy-9-methylene PGE2: stable PGE2 analog with similar effects, less side effects, equal potency in rats, gerbils, primates.</p>Formula:C21H34O4Color and Shape:SolidMolecular weight:350.499Sarafotoxin S6a
CAS:Endothelin receptor agonist (EC50 values are 7.5 and > 150 nM for contraction of pig coronary artery and guinea pig aorta respectively). Nociceptive in vivo.Formula:C105H156N28O34S5Purity:98%Color and Shape:SolidMolecular weight:2514.85Poly-D-lysine hydrobromide (MW 150000-300000)
<p>Poly-D-lysine hydrobromide (MW 150000-300000) enhances neural cell adhesion in culture and acts as a calcium-sensing receptor agonist peptide in research.</p>Color and Shape:Odour SolidHemopressin (human, mouse)
CAS:<p>Endogenous peptide, inhibits ep24.15/24.16/ACE with Ki of 27.76/3.43/1.87 μM. Lowers blood pressure, CB1 inverse agonist, reduces pain in vivo.</p>Formula:C50H79N13O12Purity:98%Color and Shape:SolidMolecular weight:1054.26α1A-AR Degrader 9c
CAS:<p>α1A-AR Degrader 9c is a potent, selective, and reversible PROTAC degrader targeting the α1A adrenergic receptor (α1A-AR) with a DC50 of 2.86 μM.</p>Formula:C38H43N11O11Purity:98%Color and Shape:SolidMolecular weight:829.825-HT2A receptor agonist-5
CAS:<p>5-HT2A receptor agonist-5 (compound I-3) is a potent 5-HT2A agonist with a Ki value of 0.017 µM and exhibits antidepressant activity.</p>Formula:C23H29N3OColor and Shape:SolidMolecular weight:363.5Upacicalcet HCl
<p>Upacicalcet HCl, a calcium mimetic, reduces blood PTH by targeting parathyroid receptors; treats secondary hyperparathyroidism.</p>Formula:C11H15Cl2N3O6SPurity:98.56%Color and Shape:SoildMolecular weight:388.22Prostaglandin D2 methyl ester
CAS:<p>PGD2: made in mast cells during allergic reactions, causes vasodilation and inhibits blood clots. PGD2 methyl ester is a similar, fat-soluble prodrug.</p>Formula:C21H34O5Color and Shape:SolidMolecular weight:366.498PG 106 acetate
<p>PG 106 acetate: Selective hMC3 receptor antagonist, IC50=210 nM; inactive on hMC5 and hMC4, EC50=9900 nM.</p>Formula:C53H73N13O11Purity:98.24%Color and Shape:SolidMolecular weight:1068.23GLP-1 moiety from Dulaglutide
<p>GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist.</p>Formula:C149H221N37O49Purity:98%Color and Shape:SolidMolecular weight:3314.62Cannabidiolic acid methyl ester
CAS:<p>Cannabidiolic acid methyl ester (HU-580) is an orally active analogue of cannabidiolic acid. It enhances the activation of 5-HT1A receptors and increases the expression of c-Fos and NeuN in specific hypothalamic nuclei in rats. Cannabidiolic acid methyl ester exhibits anti-nausea, anxiolytic, and anti-nociceptive effects.</p>Formula:C23H32O4Color and Shape:SolidMolecular weight:372.5Surfagon
CAS:Surfagon is an effective LHRH agonist.Formula:C56H78N16O12Purity:98%Color and Shape:SolidMolecular weight:1167.34AR ligand 40
<p>AR ligand 40 (compound 19c) is an Adenosine A1 Receptor ligand with antagonistic activity. It exhibits antiproliferative effects on SW480, SW48, HCT116, K562, MDA-MB-231, and A549 cells, with EC50 values of 7, 10, 12, 13, 15, and 39 μM, respectively.</p>Formula:C21H25N5Color and Shape:SolidMolecular weight:347.211INCB 3284 dimesylate
CAS:INCB 3284 dimesylate: oral CCR2 antagonist, blocks MCP-1/hCCR2 binding (IC50: 3.7 nM), potential in acute liver failure research.Formula:C28H39F3N4O10S2Purity:98%Color and Shape:SolidMolecular weight:712.76Histamine H4 receptor antagonist-1
CAS:<p>Histamine H4 receptor antagonist-1 is a potent antagonist of the histamine H4 receptor.</p>Formula:C30H38N8O2Color and Shape:SolidMolecular weight:542.68GPR55 agonist 4
<p>GPR55 agonist 4 (Compound 28), with an EC50 of 131 nM for hGPR55 and 1.41 nM for rGPR55, effectively induces β-arrestin recruitment to human GPR55 [1].</p>Formula:C19H16FN5O2Color and Shape:SolidMolecular weight:365.36O-Desethyl Dapagliflozin
CAS:<p>O-Desethyl Dapagliflozin (Empagliflozin-4) is a SGLT2 inhibitor, IC50=33nM.</p>Formula:C19H21ClO6Purity:98.33%Color and Shape:SolidMolecular weight:380.82Cetirizine Impurity D
CAS:<p>Cetirizine Impurity D, an antihistamine derivative, acts as a long-lasting H1-receptor antagonist with antiallergic effects.</p>Formula:C30H28Cl2N2Color and Shape:SolidMolecular weight:487.46ACT-1016-0707
CAS:<p>ACT-1016-0707 is a selective, insurmountable LPA1 antagonist with antifibrotic and anti-inflammatory activity in lung fibrosis models</p>Formula:C19H23ClN4O4SPurity:99.905%Color and Shape:SolidMolecular weight:438.93J-115814
CAS:<p>J-115814 is a potent feeding stimulant.</p>Formula:C29H38ClN5O3SColor and Shape:SolidMolecular weight:572.16Agaridoxin
CAS:<p>Agaridoxin is a mushroom metabolite.</p>Formula:C11H14N2O5Color and Shape:SolidMolecular weight:254.242(R)-V-0219 hydrochloride
<p>(R)-V-0219 hydrochloride: Oral GLP-1R PAM, enantiomer of V-0219, triggers Ca2+ flux in hGLP-1R HEK cells.</p>Formula:C20H26ClF3N4O2Color and Shape:SolidMolecular weight:446.89GM-60186
GM-60186, a potent inhibitor of the 5-HT receptor 2B (HTR2B) with an IC50 of 257 nM, effectively suppresses the proliferation and migration of colorectal cancer cells.Formula:C30H33FN2O4Color and Shape:SolidMolecular weight:504.59Femoxetine
CAS:<p>Femoxetine: antidepressant, enhances morphine, inhibits MAO-A/B, boosts mice's exercise capacity.</p>Formula:C20H25NO2Purity:99.1% - 99.35%Color and Shape:SolidMolecular weight:311.42CB1R agonist 1
<p>CB1R agonist 1 (Compound '1350) is a potent full agonist of the cannabinoid-1 receptor (CB1R) with a Ki value of 0.95 nM. It demonstrates significant pain-relieving effects in various pain models, including acute thermal pain, inflammatory pain, and neuropathic pain.</p>Formula:C20H18F3N3O3SColor and Shape:SolidMolecular weight:437.435[Sar9] Substance P
CAS:<p>[Sar9]-Substance P is one of NK-1 receptor agonist. The action of SP on progesterone metabolism was mimicked by the rNK1-specific agonist [Sar-9,Met(O2)11]-SP.</p>Formula:C64H100N18O13SPurity:98%Color and Shape:SolidMolecular weight:1361.66Neuropeptide Y 13-36 (porcine)
CAS:<p>Neuropeptide Y 13-36 (porcine) is a selective neuropeptide Y2 receptor agonist.</p>Formula:C135H209N41O36Color and Shape:SolidMolecular weight:2982.408Substance P (1-9)
CAS:<p>Substance P (1-9), a nonapeptide, slows its own inactivation and stimulates neurons.</p>Formula:C52H77N15O12Purity:98%Color and Shape:SolidMolecular weight:1104.262-Methyl-N,N-dimethyltryptamine
CAS:<p>2-Methyl-N,N-dimethyltryptamine (2,N,N-TMT, compound 15) exhibits binding affinity for the serotonin (5-HT) receptor, with a pA2 value of 6.04. It plays a significant role in neurological disease research.</p>Formula:C13H18N2Color and Shape:SolidMolecular weight:202.38-iso Prostaglandin E2
CAS:<p>"8-iso PGE2: Isoprostane from arachidonic acid, potent rat renal vasoconstrictor, reduces GFR and renal flow by 80%, no BP effect."</p>Formula:C20H32O5Color and Shape:SolidMolecular weight:352.473-Deoxyglucosone
CAS:3-Deoxyglucosone(3-Deoxy-D-glucosone) is synthesized by the intermediate pathway of the melad and polyol reactions.3-Deoxyglucosone reacts rapidly with proteinFormula:C6H10O5Purity:95%Color and Shape:SolidMolecular weight:162.14RF9 acetate
<p>RF9 acetate is an effective and selective antagonist of Neuropeptide FF receptor with Ki values of 58 and 75 nM for hNPFF1R and hNPFF2R, respectively.</p>Formula:C28H42N6O5Purity:99.77%Color and Shape:SolidMolecular weight:542.67Ramelteon metabolite M-II
CAS:<p>Ramelteon M-II binds MT1/MT2 with IC50s: 208/1470 pM; it's the main metabolite and a melatonin receptor agonist.</p>Formula:C16H21NO3Purity:98%Color and Shape:SolidMolecular weight:275.34MK-7246 S enantiomer
MK-7246 S enantiomer is a potent and selective CRTH2 antagonist.Formula:C21H21FN2O4SPurity:98%Color and Shape:SolidMolecular weight:416.47Spns2-IN-2
<p>Spns2-IN-2 (compound 3a) is an inhibitor of SPNS2.</p>Formula:C22H30ClN3O2Color and Shape:SolidMolecular weight:403.95Vicasinabin
CAS:<p>Vicasinabin: potent CB2 agonist; researches chronic pain, atherosclerosis, bone mass, neuroinflammation.</p>Formula:C15H22N10OColor and Shape:SolidMolecular weight:358.41GLP-1R agonist 16
CAS:<p>Compound 115a, a GLP-1R agonist, effectively activates the GLP-1 receptor with an EC50 of 0.15 nM [1].</p>Formula:C50H58FN10O6PColor and Shape:SolidMolecular weight:945.03σ1 Receptor ligand 1
σ1 Receptor ligand 1 (compound 5I) is a σ1 receptor ligand with a Ki value of 3.9 nM. It demonstrates a high plasma protein binding rate (89%) and exhibits good metabolic stability in the presence of mouse liver microsomes and NADPH. σ1 Receptor ligand 1 is applicable in neuroscience and cancer research.Formula:C22H28N2O2Color and Shape:SolidMolecular weight:352.47PD 142893
CAS:<p>PD 142893 is a functional endothelin-stimulated vasoconstriction antagonist.</p>Formula:C50H65N7O10Purity:98%Color and Shape:SolidMolecular weight:924.09Neuropeptide FF
CAS:<p>Endogenous antiopioid peptide and agonist at NPFF1 and NPFF2 receptors (Ki values are 2.82 and 0.21 nM respectively).</p>Formula:C54H76N14O10Purity:98%Color and Shape:SolidMolecular weight:1081.27Hemokinin 1, human TFA
<p>Hemokinin-1 is a human TFA and selective NK1 agonist; also activates NK2 & NK3 and induces opioid-independent analgesia.</p>Formula:C56H85F3N14O16SColor and Shape:SolidMolecular weight:1299.42Neuropeptide Y5 receptor ligand-1
CAS:<p>Neuropeptide Y5 receptor ligand-1 (Compound 54), a carbazole derivative, acts as a powerful antagonist to the neuropeptide Y5 (NPY-5) receptor [1].</p>Formula:C19H17N3O2Color and Shape:SolidMolecular weight:319.36Fenoldopam
CAS:<p>Fenoldopam is a selective D1-like dopamine receptor partial agonist (EC50 = 57 nM).</p>Formula:C16H16ClNO3Purity:98%Color and Shape:SolidMolecular weight:305.76GB-110 hydrochloride
<p>GB-110 HCl: potent, nonpeptidic oral PAR2 agonist; triggers Ca2+ release in HT29 cells; EC50 0.28 μM.</p>Formula:C33H49ClN6O5Color and Shape:SolidMolecular weight:645.23Pramlintide TFA
Pramlintide TFA, a polypeptide analogue of human amylin and an antidiabetic agent, exhibits antineoplastic properties in colorectal cancer [1].Formula:C173H268N51F3O55S2Color and Shape:SolidMolecular weight:4063.415-keto Latanoprost
CAS:<p>Latanoprost, a PG analog for ocular pressure, metabolizes into 15-keto latanoprost, a less potent variant reducing intraocular pressure and pupil size.</p>Formula:C26H38O5Color and Shape:SolidMolecular weight:430.58Benzoquinamide hydrochloride
CAS:<p>Benzoquinamide hydrochloride (3-carbamoyl-N,N-diethyl-1,3,4,6,7,11b-hexahydro-9,11-dimethoxy-2H-benzo[a]quinolizin-2-yl acetate hydrochloride) is an antiemetic</p>Formula:C22H33ClN2O5Purity:97.13% - 99.56%Color and Shape:SolidMolecular weight:440.96d[Leu4,Lys8]-VP
CAS:<p>Vasopressin V1B agonist; Ki: 0.16nM V1B, 64nM oxytocin; weak antidiuretic/vasopressor; minimal oxytocic action.</p>Formula:C47H67N11O11S2Purity:98%Color and Shape:SolidMolecular weight:1026.2Dexchlorpheniramine free base
CAS:<p>Dexchlorpheniramine Maleate, a histamine receptor antagonist, is used to treat urticaria, allergic rhinitis, allergic conjunctivitis and pruritus.</p>Formula:C16H19ClN2Purity:98%Color and Shape:Oily Liquid SolidMolecular weight:274.79Alosetron
CAS:<p>Alosetron, a 5-HT3 antagonist, is used for the management of severe diarrhea-predominant irritable bowel syndrome (IBS) in women only.</p>Formula:C17H18N4OPurity:98%Color and Shape:Crystalline PowderMolecular weight:294.36[D-Trp8]-γ-MSH
CAS:<p>[D-Trp8]-γ-MSH is a selective melanocortin 3 (MC3) receptor agonist (IC50 values are 6.7, 340 and 600 nM for human MC3, MC5 and MC4 receptors respectively).</p>Formula:C74H99N21O16SPurity:98%Color and Shape:SolidMolecular weight:1570.79Galanin Receptor Ligand M35
CAS:<p>M35, a galanin(1-13)-bradykinin(2-9) amide, acts as a galanin antagonist in rats and inhibits mouse pancreatic islets.</p>Formula:C107H153N27O26Purity:98%Color and Shape:SolidMolecular weight:2233.6Sphinganine 1-phosphate
CAS:<p>Sphinganine 1-phosphate has protects kidney and liver through activation of the S1P1 receptor in mice and acts as an agonist for S1P4 in Homo sapien.</p>Formula:C18H40NO5PColor and Shape:SolidMolecular weight:381.49B7-33
CAS:B7-33 is a single-chain relaxin analog and a selective agonist for relaxin receptor 1 (RXFP1). It binds to RXFP1 and preferentially activates the pERK pathway in cells expressing RXFP1, rather than cAMP. B7-33 serves as an antifibrotic agent and provides cardioprotective effects.Formula:C131H229N41O36SColor and Shape:SolidMolecular weight:2986.54[Ala11,D-Leu15]-Orexin B acetate
<p>[Ala11,D-Leu15]-Orexin B acetate is a selective agonist of orexin-2 receptor (OX2) with an EC50 of 0.13 nM, showing 400-fold selectivity over OX1 (52 nM).</p>Formula:C122H210N44O37SPurity:98.18%Color and Shape:SolidMolecular weight:2917.31(±)14(15)-EpETE
CAS:<p>(±)14(15)-EpETE is an intestinal microbial lipid metabolite that attenuates cisplatin chemotherapy-induced nausea in rats by inhibiting Substance P release.</p>Formula:C20H30O3Color and Shape:SolidMolecular weight:318.45Protease-Activated Receptor-1 antagonist 2
CAS:<p>Orally active PAR-1 antagonist with 7 nM IC50; potential for CVD research.</p>Formula:C24H23F2N3O2Color and Shape:SolidMolecular weight:423.46Spantide I
CAS:<p>Spantide antagonizes both bombesin & substance P. It is also tachykinin receptor antagonist.</p>Formula:C75H108N20O13Purity:98%Color and Shape:SolidMolecular weight:1497.79γ1-MSH
CAS:<p>Endogenous melanocortin MC3 receptor agonist (pKi = 7.46) that displays ~ 40-fold selectivity over MC4.</p>Formula:C72H97N21O14SPurity:98%Color and Shape:SolidMolecular weight:1512.76S 16474
CAS:S 16474 is an antagonist of Neurokinin-1 Receptor.Formula:C44H48N6NaO8Purity:98%Color and Shape:SolidMolecular weight:811.892DOAM
CAS:<p>DOAM is an antagonist of the 5-HT2 receptor.</p>Formula:C16H27NO2Color and Shape:SolidMolecular weight:265.39GLP-1R agonist 27
<p>GLP-1R agonist 27 (compound 21) is a potent and orally active GLP-1R agonist. It enhances the accumulation of cyclic adenosine monophosphate (cAMP), reduces blood glucose levels, and decreases food intake. GLP-1R agonist 27 shows potential for research in obesity and type 2 diabetes mellitus (T2DM).</p>Formula:C32H33N5O4SeColor and Shape:SolidMolecular weight:630.6MDL 29913
CAS:NK2 tachykinin receptor selective antagonist.Formula:C40H56N8O6Purity:98%Color and Shape:SolidMolecular weight:745BMS-604992 free base
CAS:<p>BMS-604992 (EX-1314), a selective GHSR agonist, binds strongly (ki=2.3 nM), is orally active, and increases rodent food intake.</p>Formula:C24H31N7O5Color and Shape:SolidMolecular weight:497.556Conessine hydrobromide
CAS:<p>Conessine hydrobromide is a naturally occurring steroid alkaloid and has been used in traditional herbal medicine as a treatment for amoebic dysentery.</p>Formula:C24H41BrN2Color and Shape:SolidMolecular weight:437.51Vapiprost hydrochloride
CAS:<p>Vapiprost hydrochloride is a biochemicla.</p>Formula:C30H40ClNO4Color and Shape:SolidMolecular weight:514.1MM 07
CAS:<p>Biased agonist for apelin/G protein pathway, enhances eNOS and cell growth, reduces apoptosis, improves heart function, and dilates vessels.</p>Formula:C67H106N22O14S3Purity:98%Color and Shape:SolidMolecular weight:1539.9Mosliciguat
CAS:<p>Mosliciguat is a guanylate cyclase activator.</p>Formula:C41H36ClF3N2O5Color and Shape:SolidMolecular weight:729.19Obestatin(rat)
CAS:<p>Endogenous peptide that suppresses food intake and body weight-gain</p>Formula:C114H174N34O31Purity:98%Color and Shape:SolidMolecular weight:2516.815-HT2C agonist-4
CAS:<p>Compound 3i, a 5-HT2C agonist-4, acts as an agonist for the 5-HT2C receptor with an EC50 of 5.7 nM. It is capable of reducing locomotor activity in zebrafish larvae.</p>Formula:C24H25N5OColor and Shape:SolidMolecular weight:399.49ARC 239 dihydrochloride
CAS:<p>ARC 239 dihydrochloride is a selective α2B adrenoceptor antagonist (pKD values are 8.8, 6.7 and 6.4 at α2B, α2A, and α2D receptors respectively).</p>Formula:C24H31Cl2N3O3Purity:99.72%Color and Shape:SolidMolecular weight:480.43Tecastemizole
CAS:<p>Tecastemizole (R 43512) is a selective antagonist of H1 receptor and a major metabolite of astemizole with anti-inflammatory effects.</p>Formula:C19H21FN4Purity:99.70%Color and Shape:SolidMolecular weight:324.4HAEGTFTSDVS acetate
<p>HAEGTFTSDVS acetate is the first N-terminal 1-11 residues of GLP-1 which stimulates insulin secretion from pancreatic β-cells.</p>Formula:C50H75N13O22Purity:97.47%Color and Shape:SolidMolecular weight:1210.2Brexpiprazole S-oxide
CAS:<p>Brexpiprazole S-oxide is the main metabolite of Brexpiprazole, a human 5-HT1A and dopamine receptor partial agonist (Ki: 0.12, 0.3 nM).</p>Formula:C25H27N3O3SPurity:98%Color and Shape:SolidMolecular weight:449.57Dapoxetine
CAS:<p>Dapoxetine (Dapoxetina) is a selective serotonin reuptake inhibitor, for the treatment of premature ejaculation.</p>Formula:C21H23NOPurity:99.73%Color and Shape:White To Off-White Crystalline PowderMolecular weight:305.42Eledoisin Related Peptide
CAS:<p>Eledoisin Related Peptide (Eledoisin RP) is a tachykinin receptor ligand.</p>Formula:C34H58N8O6SPurity:98%Color and Shape:SolidMolecular weight:706.94Maridebart
CAS:<p>Maridebart is a humanized IgG1-kappa monoclonal antibody that targets the GIPR (gastric inhibitory polypeptide receptor) [1].</p>Color and Shape:LiquidTiaprost
CAS:Tiaprost is a analog of prostaglandin F2α .Formula:C20H28O6SPurity:98%Color and Shape:SolidMolecular weight:396.5Oxyntomodulin
CAS:<p>GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.</p>Formula:C192H295N59O60SPurity:98%Color and Shape:SolidMolecular weight:4421.86(3R,5R,6S)-Atogepant
<p>(3R,5R,6S)-Atogepant (MK-8031) is a CGRP antagonist enantiomer used in migraine research.</p>Formula:C29H23F6N5O3Color and Shape:SolidMolecular weight:603.52

