GPCR/G-Protein
GPCR/G-Protein inhibitors are compounds that target G-protein coupled receptors (GPCRs) and associated G-proteins, which play critical roles in transmitting signals from the outside to the inside of cells. These inhibitors are essential for studying the signaling pathways mediated by GPCRs, which are involved in numerous physiological processes, including sensory perception, immune response, and neurotransmission. GPCR inhibitors are also important in drug development, as many therapeutic agents target these receptors. At CymitQuimica, we offer a wide range of high-quality GPCR/G-Protein inhibitors to support your research in pharmacology, cell biology, and related fields.
Subcategories of "GPCR/G-Protein"
- 5-HT Receptor(1,025 products)
- Adenosine Receptor(248 products)
- Adrenergic Receptor(3,031 products)
- Bombesin Receptor(35 products)
- Bradykinin Receptor(61 products)
- CXCR(154 products)
- CaSR(34 products)
- Cannabinoid Receptor(216 products)
- Cholecystokinin(1 products)
- Dopamine Receptor(445 products)
- Endothelin Receptor(86 products)
- GNRH Receptor(84 products)
- GPCR19(33 products)
- GRK(33 products)
- GTPase(22 products)
- Glucagon Receptor(191 products)
- Hedgehog/Smoothened(49 products)
- Histamine Receptor(385 products)
- LPA Receptor(21 products)
- Melatonin Receptor(26 products)
- OX Receptor(41 products)
- Opioid Receptor(325 products)
- PAFR(14 products)
- PKA(59 products)
- S1P Receptor(17 products)
- SGLT(31 products)
- Sigma receptor(46 products)
Show 19 more subcategories
Found 5963 products of "GPCR/G-Protein"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Color and Shape:SolidMolecular weight:3692.15Bradykinin (1-3)
CAS:Bradykinin (1-3) is a fragment of Bradykinin. Bradykinin is an activates pain receptors.
Formula:C16H28N6O4Purity:98%Color and Shape:SolidMolecular weight:368.43Neurokinin A TFA
CAS:Neurokinin A TFA (NKA TFA) is a neuropeptide within the neurokinin family, serving as the endogenous ligand and agonist for the NK-2 (Neurokinin 2) receptor.Formula:C52H81F3N14O16SPurity:98.704%Color and Shape:SolidMolecular weight:1247.34[Tyr22] Calcitonin Gene Related Peptide, (22-37), rat
CAS:[Tyr22] CGRP (22-37), rat is a fragment of rat CGRP, targeting its receptor and adenylate cyclase, produced by thyroid and stored in the nervous system.Formula:C82H120N20O25Color and Shape:SolidMolecular weight:1785.95d[Leu4,Lys8]-VP acetate
d[Leu4,Lys8]-VP acetate: Vasopressin V1b agonist. Ki: rat 0.16 nM, human 0.52 nM, mouse 1.38 nM. Low antidiuretic/vasopressor effects.Formula:C49H71N11O13S2Purity:98.86%Color and Shape:SolidMolecular weight:1086.28Neuropeptide Y 13-36 (porcine)
CAS:Neuropeptide Y 13-36 (porcine) is a selective neuropeptide Y2 receptor agonist.Formula:C135H209N41O36Color and Shape:SolidMolecular weight:2982.408ZL-1101
ZL-1101 is a human monoclonal antibody (mAb) targeting TNFRSF4/OX40/CD134.Color and Shape:Odour LiquidIlatreotide
CAS:Ilatreotide is a Amadori compound of octreotide.Formula:C61H86N10O20S2Purity:98%Color and Shape:SolidMolecular weight:1343.538-iso-16-cyclohexyl-tetranor Prostaglandin E2
CAS:8-iso PGE2, a lipid peroxidation byproduct, has a synthetic variant, 8-iso-16-cyclohexyl-tetranor PGE2, unstudied pharmacologically.Formula:C22H34O5Color and Shape:SolidMolecular weight:378.509GLP-1 moiety from Dulaglutide
GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist.Formula:C149H221N37O49Purity:98%Color and Shape:SolidMolecular weight:3314.62A71378
CAS:A71378 is a high potency, selectivity CCK-A receptors agonist.Formula:C48H62N8O13SPurity:98%Color and Shape:SolidMolecular weight:991.12Obestatin(rat)
CAS:Endogenous peptide that suppresses food intake and body weight-gainFormula:C114H174N34O31Purity:98%Color and Shape:SolidMolecular weight:2516.81(+)-OSU 6162
CAS:(+)-OSU 6162 (Piperidine, 3-[3-(methylsulfonyl)phenyl]-1-propyl-, (3R)-) is an agonist of 5-HT Receptor with anti-Alzheimer and antidepressant activities.Formula:C15H23NO2SPurity:98.19%Color and Shape:SoildMolecular weight:281.41Ref: TM-T60027
1mg77.00€5mg155.00€10mg220.00€25mg338.00€50mg472.00€100mg632.00€200mg853.00€1mL*10mM (DMSO)163.00€Biotin-NeurokininA
Biotin-NeurokininA: biotinylated peptide, NK-2 receptor agonist, key in human airway and gut function.Formula:C60H94N16O16S2Color and Shape:SolidMolecular weight:1359.61GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Color and Shape:SolidMolecular weight:3850.315-MeO-MET
CAS:5-MeO-MET (5-Methoxy-N-methyl-N-ethyltryptamine) is a compound belonging to the 5-methoxytryptamine class. It acts as an agonist for 5-HT1A and 5-HT2A receptors. In mice, 5-MeO-MET inhibits locomotion and has sedative effects.Formula:C14H20N2OColor and Shape:SolidMolecular weight:232.32LTD4 antagonist 2
CAS:LTD4 antagonist 2 (compound 6) functions as a leukotriene D4 (LTD4) antagonist with an IC50 of 2.8 μM for the cysteinyl leukotriene 1 receptor (CysLT1R). Additionally, it acts as an agonist for the G protein-coupled bile acid receptor 1 (GPBAR1), making it applicable for research into colitis, metabolic syndrome, and other GPBAR1- and CysLT1R-related diseases.Formula:C17H13NO3Color and Shape:SolidMolecular weight:279.29PSB-SB-1203
CAS:PSB-SB-1203 (Compound 25b) is a dual CB1/CB2 ligand that blocks the CB1 receptor and activates the CB2 receptor with a CB1 Ki of 0.244 μM, a CB2 Ki of 0.210 μM, and an EC50 of 0.054 μM. It shows potential for research in obesity and cancer.Formula:C25H30O4Color and Shape:SolidMolecular weight:394.5Vortioxetine D8
CAS:Vortioxetine D8 is a deuterium-labeled antidepressant inhibiting 5-HT1A/B, 5-HT3A, 5-HT7 receptors & SERT (Ki: 15-1.6 nM).Formula:C18H22N2SPurity:98%Color and Shape:SolidMolecular weight:306.5Brexpiprazole S-oxide D8
CAS:Brexpiprazole S-oxide D8 (DM-3411 D8) is a deuterium-labeled metabolite of Brexpiprazole, a partial agonist at 5-HT1A and dopamine receptors.Formula:C25H19D8N3O3SPurity:98%Color and Shape:SolidMolecular weight:457.6115(S)-15-methyl Prostaglandin E2
CAS:15(S)-15-methyl PGE2: A stable PGE2 analog; strong antiulcer with double PGE2 affinity; excels PGE1 in uterine contraction.Formula:C21H34O5Color and Shape:SolidMolecular weight:366.49Sulfatroxazole
CAS:Sulfatroxazole (Isosulfafurazole) (compound 12) is a selective antagonist of the ETA receptor with an IC50 of 0.26 μM.Formula:C11H13N3O3SColor and Shape:SolidMolecular weight:267.3CACPD2011a-0001278239
CAS:CACPD2011a-0001278239 is a β2AR hybrid agonist with high affinity binding to both the wild-type and T164I β2AR variants. It exhibits neither cytotoxicity nor mutagenicity, making it suitable for asthma research.Formula:C21H22N4O4Color and Shape:SolidMolecular weight:394.42Cannabidivarinic acid
CAS:Cannabidivarinic acid (CBDVA), the carboxylic acid precursor to cannabidivarin (CBDV), is a non-psychoactive cannabinoid found in Cannabis and known for its anti-inflammatory properties.Formula:C20H26O4Color and Shape:SolidMolecular weight:330.42Esmolol acid hydrochloride
CAS:Esmolol acid (ASL-8123) hydrochloride is a mild antagonist of β-adrenergic receptors. It inhibits the heart rate and diastolic pressure responses induced by Isoproterenol in a dose-dependent manner and is applicable for renal failure research.Formula:C15H24ClNO4Color and Shape:SolidMolecular weight:317.81ATMW-2
ATMW-2 is an antagonist engineered using NeuralGenThesis (NGT) technology, specifically targeting the melanocortin 2 receptor (MC2R).Formula:C27H29ClN2O4Color and Shape:SolidMolecular weight:480.98Moperone
CAS:Moperone (R 1658) is an antagonist of both the D2 dopamine receptor (D2 dopamine receptor) and the D3 dopamine receptor (D3 dopamine receptor), with IC50 values for each of 1.0 nM.Formula:C22H26FNO2Color and Shape:SolidMolecular weight:355.457-Methyl DMT
CAS:7-Methyl DMT (7-TMT) acts as a 5-HT2 receptor agonist. Structurally, it is a tryptamine derivative and serves as an analytical reference for the psychoactive substance DOM. It is also applicable in research related to neurological disorders.Formula:C13H18N2Color and Shape:SolidMolecular weight:202.3Bay 55-9837
CAS:Selective VPAC2 agonist; EC50: 0.4 nM (VPAC2), 100 nM (VPAC1), >1000 nM (PAC1). Enhances insulin secretion, reduces HIV-1 replication.Formula:C167H270N52O46Purity:98%Color and Shape:SolidMolecular weight:3742.29Melatonin-Tamoxifen Conjugate
Melatonin-Tamoxifen Conjugate (compound 16c) is an anticancer drug conjugate made of Melatonin and Tamoxifen, serving as an effective antagonist of ERα (IC50 = 863 nM). In cells expressing the hMT1 receptor, it binds to MLT receptors (Ki = 3.1 nM) and exhibits the ability to promote β-arrestin activation (EC50 = 914 nM) and ERK activation (EC50 = 98 nM). The IC50 values for Melatonin-Tamoxifen Conjugate in MCF-7, MDA-MB-231, and HT-1080 cell lines are 6.8 μM, 6.4 μM, and 1.7 μM, respectively.Formula:C47H58N4O4Color and Shape:SolidMolecular weight:742.99V1a/V2 antagonist 1
V1a/V2 antagonist 1 (Compound 18j) is an orally active dual-target antagonist of V1a and V2 receptors, exhibiting high binding affinity toward these receptors [Ki values are hV1a: 0.13 nM, hV2: 0.53 nM, and mV1a: 0.5 nM; IC50 for hV1a is 2.2 nM]. This compound can inhibit oxytocin-induced scratching behavior in mice.Formula:C25H26ClN5O3Color and Shape:SolidMolecular weight:479.9625E-NBOMe hydrochloride
CAS:25E-NBOMe hydrochloride is a derivative of 2C-E, featuring an N-(2-methoxybenzyl) addition to the amine group, and acts as a selective agonist of the 5-HT2A receptor.Formula:C20H28ClNO3Color and Shape:SolidMolecular weight:365.894-Iodoamphetamine hydrochloride
CAS:4-Iodoamphetamine (p-Iodoamphetamine) hydrochloride is a halogenated phenethylamine characterized by the presence of an iodine atom at the para position of the phenyl group. It selectively induces serotonin release and inhibits reuptake in rat brain synaptosomes.Formula:C9H13ClINColor and Shape:SolidMolecular weight:297.56Adrogolide HCl
CAS:Adrogolide Hydrochloride is a selective dopamine receptor D1 agonist.Formula:C22H26ClNO4SColor and Shape:SolidMolecular weight:435.96MMC(TMZ)-TOC TFA
MMC(TMZ)-TOC TFA exhibits high binding affinity and selectivity for the somatostatin receptor subtype 2 (SSTR2). It targets the delivery of TMZ to SSTR2-positive tumor cells, making MMC(TMZ)-TOC TFA useful for cancer research.Formula:C74H99F3N20O21S2Color and Shape:SolidMolecular weight:1725.82Δ8-THC methyl ether
CAS:Δ8-THC methyl ether (compound 3) demonstrates a strong docking score of -10.167 kcal/mol for the CB2 receptor. Additionally, Δ8-THC methyl ether exhibits antinociceptive activity in mice.Formula:C22H32O2Color and Shape:SolidMolecular weight:328.494-hydroxy DiPT hydrochloride
CAS:4-hydroxy DiPT (hydrochloride) is a 5-HT2A agonist that can induce head twitch response (HTR) in mice, indicating its hallucinogenic potential. This compound holds promise for research into hallucinogens.Formula:C16H25ClN2OColor and Shape:SolidMolecular weight:296.84Antisauvagine-30 TFA
aSvg-30 TFA: potent CRF2 receptor antagonist, Kd 1.4 nM (mCRFR2β), 150 nM (CRFR1).Formula:C163H275N48F3O49SColor and Shape:SolidMolecular weight:3764.28O-Desmethyl Mebeverine alcohol hydrochloride
CAS:O-Desmethyl Mebeverine alcohol HCl, a metabolite of Mebeverine, is a strong α1 inhibitor, relaxing the GI tract.Formula:C15H26ClNO2Color and Shape:SolidMolecular weight:287.83SBI-810
CAS:SBI-810 is a functional selective β-arrestin-biased allosteric modulator of the neurotensin receptor 1 (NTSR1). In the presence of the endogenous ligand neurotensin (NT), SBI-810 regulates NTSR1 signaling through a G protein-specific mechanism. It fully antagonizes NT-induced Gq activation and partially antagonizes NT-induced Gi1 activation, allowing NTSR1 to activate GoA and G12.Formula:C27H34N4O2Color and Shape:SolidMolecular weight:446.59CB2 receptor agonist 9
CAS:CB2 receptor agonist 9 (Compound 33) is an orally active agonist of cannabinoid receptor 2 (CB2 receptor) with an EC50 of 16.2 nM. It inhibits the expression of TNF-α, IL-1β, and IL-6, demonstrating anti-inflammatory activity in a DSS-induced acute colitis model in mice.Formula:C16H23N3O2SColor and Shape:SolidMolecular weight:321.44(±)-9-Nor-9α-hydroxy Hexahydrocannabinol
CAS:(±)-9-Nor-9α-hydroxy Hexahydrocannabinol is a cannabinoid-structured compound that exhibits potent cannabinoid-like activity in both dogs and mice.Formula:C20H30O3Color and Shape:SolidMolecular weight:318.45N-Nitroso Atenolol
CAS:N-Nitroso Atenolol is a derivative of Atenolol. At concentrations ranging from 0.1 to 1 mM, it induces DNA fragmentation in rat hepatocytes.Formula:C14H21N3O4Color and Shape:SolidMolecular weight:295.33QWF acetate
QWF acetate is a Substance P antagonist peptide that specifically inhibits the binding to its receptor, NK1, and inhibits the activation of MRGPRX2.
Formula:C40H47N5O10Purity:96.65%Color and Shape:SolidMolecular weight:757.84Survodutide TFA
Survodutide TFA (BI 456906 TFA) is a GCGR/GLP-1R dual agonist, a peptide compound used in obesity research.Formula:C192H289N47O61·xC2HF3OC2Purity:99.29% - 99.96%Color and Shape:SolidMolecular weight:4231.62 (free base)Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Acetate
CAS:Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Acetate is an NPR-A agonist and ANP hormone. Carperitide increases cGMP levels and reduces the heart's workload.Formula:C129H207N45O41S3Purity:99.78%Color and Shape:SoildMolecular weight:3140.5Amisulpride hydrochloride
CAS:Amisulpride is an antagonist of 5-HT7 receptor and dopamine D2 and D3 receptors. It modulates beta 2- arresting signaling and increases neurite outgrowth.Formula:C17H28ClN3O4SColor and Shape:SolidMolecular weight:405.94VU0453379 hydrochloride
VU0453379 hydrochloride: selective CNS-penetrant GLP-1R PAM, EC50 1.3 μM.Formula:C26H35ClN4O2Color and Shape:SolidMolecular weight:471.03Mazdutide acetate(2259884-03-0 free base)
Mazdutide acetate is a potent (GLP-1R and GCGR agonist that stimulates insulin secretion from mouse pancreatic islets , which can be used to study obesity.Purity:98.41%Color and Shape:Odour SolidOrexin A (human, rat, mouse) acetate
Orexin A (human, rat, mouse) acetate (Hypocretin-1 (human, rat, mouse) acetate) is an excitatory neuropeptide with analgesic properties.Formula:C154H247N47O46S4Color and Shape:SolidMolecular weight:3621.15
![[Tyr22] Calcitonin Gene Related Peptide, (22-37), rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT76363.webp&w=3840&q=75)
![d[Leu4,Lys8]-VP acetate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1927L1.webp&w=3840&q=75)
