GPCR/G-Protein
GPCR/G-Protein inhibitors are compounds that target G-protein coupled receptors (GPCRs) and associated G-proteins, which play critical roles in transmitting signals from the outside to the inside of cells. These inhibitors are essential for studying the signaling pathways mediated by GPCRs, which are involved in numerous physiological processes, including sensory perception, immune response, and neurotransmission. GPCR inhibitors are also important in drug development, as many therapeutic agents target these receptors. At CymitQuimica, we offer a wide range of high-quality GPCR/G-Protein inhibitors to support your research in pharmacology, cell biology, and related fields.
Subcategories of "GPCR/G-Protein"
- 5-HT Receptor(1,025 products)
- Adenosine Receptor(251 products)
- Adrenergic Receptor(3,025 products)
- Bombesin Receptor(35 products)
- Bradykinin Receptor(61 products)
- CXCR(158 products)
- CaSR(34 products)
- Cannabinoid Receptor(218 products)
- Cholecystokinin(1 products)
- Dopamine Receptor(445 products)
- Endothelin Receptor(86 products)
- GNRH Receptor(84 products)
- GPCR19(36 products)
- GRK(33 products)
- GTPase(23 products)
- Glucagon Receptor(195 products)
- Hedgehog/Smoothened(49 products)
- Histamine Receptor(385 products)
- LPA Receptor(21 products)
- Melatonin Receptor(26 products)
- OX Receptor(41 products)
- Opioid Receptor(327 products)
- PAFR(14 products)
- PKA(60 products)
- S1P Receptor(18 products)
- SGLT(31 products)
- Sigma receptor(46 products)
Show 19 more subcategories
Found 6011 products of "GPCR/G-Protein"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Pancreatic Polypeptide, rat
CAS:Rat Pancreatic Polypeptide: 36-amino acid peptide, NPYR4 agonist, secreted by islet PP cells.Formula:C195H298N58O57SPurity:98%Color and Shape:SolidMolecular weight:4398.87L-770644
CAS:L-770644 is an agonist of B3 adrenergic receptor.Formula:C30H37N7O4SColor and Shape:SolidMolecular weight:591.72LCKLSL acetate
LCKLSL acetate is a potent AnxA2 inhibitor, blocking tPA binding and plasmin production, with anti-angiogenic effects.Formula:C32H61N7O10SPurity:99.9%Color and Shape:SolidMolecular weight:735.93Alosetron
CAS:Alosetron, a 5-HT3 antagonist, is used for the management of severe diarrhea-predominant irritable bowel syndrome (IBS) in women only.Formula:C17H18N4OPurity:98%Color and Shape:Crystalline PowderMolecular weight:294.36(+)-OSU 6162
CAS:(+)-OSU 6162 (Piperidine, 3-[3-(methylsulfonyl)phenyl]-1-propyl-, (3R)-) is an agonist of 5-HT Receptor with anti-Alzheimer and antidepressant activities.Formula:C15H23NO2SPurity:98.19%Color and Shape:SoildMolecular weight:281.41Ref: TM-T60027
1mg73.00€5mg146.00€1mL*10mM (DMSO)155.00€10mg208.00€25mg319.00€50mg447.00€100mg600.00€200mg808.00€Prostaglandin F2α isopropyl ester
CAS:PGF2α isopropyl ester is an ester prodrug of PGF2α with enhanced lipid solubility.Formula:C23H40O5Color and Shape:SolidMolecular weight:396.568EP4-IN-1
CAS:EP4-IN-1: Potent EP4 receptor inhibitor with anti-tumor, anti-inflammatory, and analgesic properties.Formula:C27H24N2O4Purity:99.94%Color and Shape:SoildMolecular weight:440.49GRK2i
CAS:GRK2 inhibitory polypeptide that specifically inhibits Gβγ activation of GRK2. Corresponds to the Gβγ-binding domain and acts as a cellular Gβγ antagonist.Formula:C153H256N50O41SPurity:98%Color and Shape:SolidMolecular weight:3484.08Antibiotic Sch 60057
CAS:Antibiotic Sch 60057 is a useful organic compound for research related to life sciences. The catalog number is T125403 and the CAS number is 203061-35-2.Formula:C45H84O6Color and Shape:SolidMolecular weight:721.161Neuropeptide Y (22-36)
CAS:Neuropeptide Y (22-36) is a 15-amino acid fragment of NPY, which is abundant in the mammalian brain and involved in multiple physiological functions.Formula:C85H139N29O21Purity:98%Color and Shape:SolidMolecular weight:1903.19GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Color and Shape:SolidMolecular weight:3850.31Galanin (2-29) (rat)
CAS:Peptide agonist for galanin receptorsFormula:C139H208N42O40Purity:98%Color and Shape:SolidMolecular weight:3107.4Fenoldopam
CAS:Fenoldopam is a selective D1-like dopamine receptor partial agonist (EC50 = 57 nM).Formula:C16H16ClNO3Purity:98%Color and Shape:SolidMolecular weight:305.76Apadenoson TFA
Apadenoson TFA is a potent adenosine A2A receptor (A2AR) agonist that can be used to improve survival in patients infected with SARS.
Formula:C25H31F3N6O8Purity:98.08%Color and Shape:SoildMolecular weight:600.55Teprotumumab
CAS:Teprotumumab: human antibody, inhibits IGF-1R, used for thyroid eye diseases.
Purity:SDS-PAGE:95.2%;SEC-HPLC:99.6%Color and Shape:LiquidMolecular weight:145.62 kDa(R)-(+)-Atenolol
CAS:(R)-(+)-Atenolol ((R)-Atenolol) is a cardioselective beta-1 adrenergic blocker, which properties are similar to propranolol, but without a negative inotropic effect.Formula:C14H22N2O3Purity:98.72%Color and Shape:SolidMolecular weight:266.34Motilin, canine
CAS:Motilin canine, a 22-amino acid peptide, functions as a robust gastrointestinal smooth muscle contraction agonist.Formula:C120H194N36O34Purity:98%Color and Shape:SolidMolecular weight:2685.05PG-931
CAS:Selective MC4 agonist with IC50: 0.58 nM (MC4), 55 nM (MC3); revives heart/lung function in shocked rats.Formula:C59H85N15O11Purity:98%Color and Shape:SolidMolecular weight:1180.41RWJ 676070
CAS:RWJ 676070 is an antagonist of vasopressin V1A/V2 receptor.Formula:C30H26ClFN2O5Color and Shape:SolidMolecular weight:548.99AC-263093
CAS:AC-263093 is an NPFFR2 agonist with anxiolytic activity that increases c-Fos protein expression in the paraventricular nucleus of the hypothalamus.Formula:C8H8Br2N4Purity:99.78%Color and Shape:SoildMolecular weight:319.98
