Organic Halides
In this category, you can find organic molecules containing one or more halogen atoms in their structure. These organic halides include brominated, iodinated, chlorinated, and cyclic halide compounds. Organic halides are widely used in organic synthesis, pharmaceuticals, agrochemicals, and materials science due to their reactivity and ability to undergo a variety of chemical transformations. At CymitQuimica, we offer a comprehensive selection of high-quality organic halides to support your research and industrial applications, ensuring reliable and effective performance in your synthetic and analytical projects.
Subcategories of "Organic Halides"
Found 20442 products of "Organic Halides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
GRP (14-27) (human, porcine, canine) trifluoroacetate salt
CAS:GRP (14-27) is a synthetic peptide that has an inhibitory effect on the growth of pancreatic cancer cells. It also inhibits the development of primary tumors in hamsters and inhibits tumor metastasis. GRP (14-27) binds to the cell surface receptor on T cells, which is responsible for mediating immune responses against tumors. GRP (14-27) has been shown to suppress tumor growth through immunoreactivity and has been found to be effective against a variety of cancers when used as an adjuvant therapy.Formula:C75H110N24O16S2Purity:Min. 95%Molecular weight:1,667.96 g/mol(Lys18)-Pseudin-2 trifluoroacetate salt
CAS:Please enquire for more information about (Lys18)-Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C122H203N37O32Purity:Min. 95%Molecular weight:2,700.15 g/molDynorphin A (1-11) amide trifluoroacetate salt
CAS:Dynorphin A (1-11) amide trifluoroacetate salt is a modified form of the opioid peptide dynorphin, which is a natural ligand for kappa-opioid receptors. It has affinity for the surface receptors and can be used to study the modifications that occur in cell function. Dynorphin A (1-11) amide trifluoroacetate salt has been shown to decrease cell function when it interacts with these surface receptors, which are found in brain homogenates and other tissues. Dynorphin A (1-11) amide trifluoroacetate salt also has an effect on brain cells, which may be due to its ability to alter conformational changes in proteins by binding to them. This can lead to alterations in the structure of certain enzymes or receptor proteins.Formula:C63H104N22O12Purity:Min. 95%Molecular weight:1,361.64 g/mol3-Iodo-1H-pyrrolo[2,3-b]pyridine
CAS:3-Iodo-1H-pyrrolo[2,3-b]pyridine (3IOP) is a molecule that has been shown to be cytotoxic against human ovarian carcinoma cells. It induces significant cytotoxicity in cancer cell lines and inhibits the proliferation of lung fibroblasts. 3IOP has been shown to activate cellular signaling pathways and cause multinuclear DNA damage.
Formula:C7H5IN2Purity:Min. 95%Color and Shape:PowderMolecular weight:244.03 g/mol3-Bromo-4-fluorophenol
CAS:3-Bromo-4-fluorophenol is a synthetic, water soluble, and stable compound with a variety of applications. It yields white crystals that are soluble in water, acetone, ethanol, ether, benzene, chloroform, and carbon tetrachloride. 3-Bromo-4-fluorophenol has been shown to have a number of structural modifications that may be advantageous for therapeutic purposes. The most prominent modification is the methylation of the phenolic hydroxyl group (functionalisation). This modification prevents the drug from reacting with nucleophilic sites on proteins and other biological molecules. 3-Bromo-4-fluorophenol interacts with methyltransferase enzymes in cancer cells to inhibit their activity. These methyltransferase enzymes are involved in cellular proliferation and proliferation signalling pathways that may lead to cancer cell death.Formula:C6H4BrFOPurity:Min. 95%Color and Shape:PowderMolecular weight:191 g/mol3-Trifluoromethyl phenylhydrazine hydrochloride
CAS:3-Trifluoromethyl phenylhydrazine HCl is a fine chemical that can be used as a versatile building block in the synthesis of complex compounds. It has been shown to be a useful intermediate for the preparation of research chemicals, reaction components and speciality chemicals. 3-Trifluoromethyl phenylhydrazine HCl belongs to CAS No. 3107-33-3 and can be used as a reagent in organic synthesis. The compound is high quality with a purity of over 99%.Formula:C7H8ClF3N2Purity:Min. 95%Color and Shape:PowderMolecular weight:212.6 g/molImidazo[1,2-a]pyridin-7-amine hydrobromide
CAS:Please enquire for more information about Imidazo[1,2-a]pyridin-7-amine hydrobromide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C7H8BrN3Purity:Min. 95%Molecular weight:214.06 g/mol2-Bromo-5-methylpyrimidine
CAS:Please enquire for more information about 2-Bromo-5-methylpyrimidine including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C5H5BrN2Purity:95%NmrMolecular weight:173.01 g/molCortistatin-29 (human) trifluoroacetate salt
CAS:Please enquire for more information about Cortistatin-29 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C149H223N47O42S3Purity:Min. 95%Molecular weight:3,440.85 g/mol4,6-Dichloro-1H-pyrazolo[4,3-c]pyridine
CAS:4,6-Dichloro-1H-pyrazolo[4,3-c]pyridine is a reagent that has been used as a building block for the synthesis of other compounds. It is also used in the preparation of a variety of organic compounds. 4,6-Dichloro-1H-pyrazolo[4,3-c]pyridine is soluble in organic solvents such as chloroform and ethanol, and can be stored at room temperature. This compound reacts with acids to produce an acid chloride that are useful for the formation of amides and esters. This product has been shown to have a high quality and is suitable for use in research or development.Formula:C6H3Cl2N3Purity:Min. 95%Color and Shape:Yellow to beige solid.Molecular weight:188.01 g/molLHRH II trifluoroacetate salt
CAS:LHRH II trifluoroacetate salt is a peptide hormone that is used to treat prostate cancer, breast cancer, and endometriosis. It binds to the ryanodine receptor in the cell membrane and induces the release of calcium from intracellular stores. LHRH II trifluoroacetate salt also promotes polymerase chain reactions which are important for DNA replication. This drug has been shown to increase epidermal growth factor (EGF) levels in carcinoma cell lines and has transcriptional regulatory activity in a model system. LHRH II trifluoroacetate salt can be used as an experimental model for clinical relevance because it can be used to study how hormones affect cellular processes such as transcriptional regulation.Formula:C60H69N17O13Purity:Min. 95%Molecular weight:1,236.3 g/molH-D-Arg(Pbf)-2-chlorotrityl resin (200-400 mesh)
Please enquire for more information about H-D-Arg(Pbf)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%2,2,2-Trifluoro-1-(3-Trimethylsilylphenyl)Ethanone
CAS:2,2,2-Trifluoro-1-(3-trimethylsilylphenyl)ethanone is a chemical that can be used as an acetylcholinesterase inhibitor. This agent is designed to inhibit the enzyme that breaks down acetylcholine, which is responsible for transmitting nerve impulses and controlling muscle contractions. The activity of 2,2,2-Trifluoro-1-(3-trimethylsilylphenyl)ethanone is reversible by hydrolysis and it has a low bioavailability due to its high lipophilicity. Acetylcholinesterase inhibitors are mainly used for the treatment of inflammatory diseases such as rheumatoid arthritis. br> The pharmacodynamics of 2,2,2-Trifluoro-1-(3-trimethylsilylphenyl)ethanone are not well understood. This drug also has side effect profilesFormula:C11H13F3OSiPurity:Min. 95%Molecular weight:246.3 g/molDynorphin A trifluoroacetate salt
CAS:Dynorphin A is a peptide that belongs to the class of opioid peptides. It acts as a kappa-opioid receptor agonist and is involved in the transmission of pain signals and other information from the central nervous system to the peripheral nervous system. Dynorphin A has been shown to inhibit the release of neurotransmitters, such as acetylcholine, dopamine, serotonin, and norepinephrine. It also blocks the action of transmitters at postsynaptic membranes by binding to their receptors. Dynorphin A binds with high affinity to kappa-opioid receptors and can be used for treatment of heroin addiction and chronic pain.Formula:C99H155N31O23Purity:Min. 95%Molecular weight:2,147.49 g/molFormyl-(D-Trp6)-LHRH (2-10) trifluoroacetate salt
CAS:Please enquire for more information about Formyl-(D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C60H77N17O12Purity:Min. 95%Molecular weight:1,228.36 g/mol(D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt
CAS:Please enquire for more information about (D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C52H72N14O12Purity:Min. 95%Molecular weight:1,085.22 g/mol6-Chloro-2-methylbenzoic acid
CAS:6-Chloro-2-methylbenzoic acid is a methyl ester that is used in the synthesis of 2-chloro-6-fluorobenzaldehyde. This chemical reacts with hydrogen peroxide to produce chloride and 2,6-dichlorobenzoic acid. The compound can also be synthesized from 2,6-dichlorobenzaldehyde and methoxyethanol. 6CMB has been shown to react with anions such as Cl-, Br-, NO2-, SO3H, and PO3H2 to form organic carboxylates or sulfoxides. It has also been shown to be a byproduct of the reaction between chloral hydrate and potassium permanganate.
Formula:C8H7ClO2Purity:90%Color and Shape:PowderMolecular weight:170.59 g/molMca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C49H68N14O15Purity:Min. 95%Molecular weight:1,093.15 g/molH-Cys(Trt)-2-chlorotrityl resin (200-400 mesh)
Please enquire for more information about H-Cys(Trt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt
CAS:Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C162H243N45O52S2Purity:Min. 95%Molecular weight:3,717.07 g/mol(R)-(+)-3-Chloro-1-phenyl-1-propanol
CAS:(R)-(+)-3-Chloro-1-phenyl-1-propanol is a substrate for the lactamase of bacteria. The immobilized lipase catalyzes the hydrolysis reaction in which the lactam ring is broken, yielding a propiophenone intermediate. This intermediate can be converted to (S)-(+)-3-chloro-1-phenylpropanol by treatment with an alcohol oxidase or by hydrolysis with hydrogen peroxide. The product has been shown to have antidepressant activity and may modulate the dry weight of bacteria. In vivo studies show that this compound has a high concentration in rats and mice, but it is not active in humans.Formula:C9H11ClOPurity:Min. 95%Color and Shape:White To Yellow SolidMolecular weight:170.64 g/mol(2-Bromopyridin-4-yl)methanamine
CAS:Please enquire for more information about (2-Bromopyridin-4-yl)methanamine including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%(Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt
CAS:Please enquire for more information about (Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C39H60N10O8Purity:Min. 95%Molecular weight:796.96 g/molH-D-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh)
Please enquire for more information about H-D-Cys(4-methoxytrityl)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%H-Leu-2-chlorotrityl resin (200-400 mesh)
Please enquire for more information about H-Leu-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%DL-Methionine methylsulfonium chloride
CAS:DL-Methionine methylsulfonium chloride is a fine chemical that has many uses. It can be used as a versatile building block for research and synthesis of complex compounds, or as an intermediate for the production of speciality chemicals. DL-Methionine methylsulfonium chloride is also useful as a reaction component in organic synthesis and as a reagent in analytical chemistry. It is often used to introduce methionine residues into proteins, which are then used for structural studies and protein engineering. The quality of this compound is high and it has CAS number 3493-12-7.Formula:C6H14ClNO2SColor and Shape:White PowderMolecular weight:199.7 g/mol2-Chloropyridine-4-boronic acid
CAS:2-Chloropyridine-4-boronic acid is a nicotinic acetylcholine receptor antagonist that has been shown to be effective against trypanosomiasis. It blocks the binding of acetylcholine to its receptor, which prevents the propagation of an action potential in the postsynaptic cell. 2-Chloropyridine-4-boronic acid inhibits the enzymes cyclooxygenase and prostaglandin synthase, which are involved in inflammation. 2-Chloropyridine-4-boronic acid is potent and selective for nicotinic acetylcholine receptors, but it also binds to other sites on the enzyme. The molecular modeling studies have shown that this compound has a pharmacophore that can be used as a guide for drug design.
Formula:C5H5BClNO2Purity:Min. 95%Molecular weight:157.36 g/molCys-Gly-His-Gly-Asn-Lys-Ser-Amyloid b-Protein (33-40) trifluoroacetate salt
CAS:Please enquire for more information about Cys-Gly-His-Gly-Asn-Lys-Ser-Amyloid b-Protein (33-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C58H99N19O18S2Purity:Min. 95%Molecular weight:1,414.66 g/molTRAP-14 trifluoroacetate salt
CAS:TRAP-14 is a conformationally restricted peptide that binds to the thrombin receptor. TRAP-14 also has a biocompatible polymer backbone that can be used in vivo as an implant. The TRAP-14 peptide has been shown to inhibit thrombin activity and inhibit the expression of basic fibroblast growth factor. In addition, this drug showed an ability to suppress autoimmune diseases in vivo by blocking Ca2+ release from the cytosol. This drug also showed inhibition of polymerase chain reaction (PCR) amplification and increased the specificity of PCR for DNA sequences containing polyvinyl disulfide bonds.Formula:C81H118N20O23Purity:Min. 95%Molecular weight:1,739.92 g/mol4,4-Difluoro-N-((1S)-3-oxo-1-phenylpropyl)cyclohexanecarboxa
CAS:Please enquire for more information about 4,4-Difluoro-N-((1S)-3-oxo-1-phenylpropyl)cyclohexanecarboxa including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C16H19F2NO2Purity:Min. 95%Molecular weight:295.32 g/molMethyl 2-amino-6-bromobenzoate
CAS:Please enquire for more information about Methyl 2-amino-6-bromobenzoate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C8H8BrNO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:230.06 g/molBiotinyl-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:Please enquire for more information about Biotinyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C204H309N55O60S2Purity:Min. 95%Molecular weight:4,556.1 g/molCART (55-76) (rat) trifluoroacetate salt
CAS:Please enquire for more information about CART (55-76) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C107H166N26O33S3Purity:Min. 95%Molecular weight:2,440.82 g/molMethoxycarbonyl-Lys(Z)-Gly-Arg-pNA hydrochloride salt
CAS:Please enquire for more information about Methoxycarbonyl-Lys(Z)-Gly-Arg-pNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C30H41N9O9Purity:Min. 95%Molecular weight:671.7 g/molProkineticin 2 Isoform 2 (human) trifluoroacetate salt
CAS:Prokineticin-2 is a protein that is encoded by the PROK2 gene. It has been shown to inhibit VEGF in vitro and to be anti-inflammatory. Prokineticin-2 binds to the receptor for colony stimulating factor 1 (CSF1) and promotes angiogenesis by inducing the production of angiogenic factors such as vascular endothelial growth factor (VEGF), erythropoietin, and granulocyte macrophage colony stimulating factor (GM-CSF). It also inhibits transcriptional regulation of genes involved in inflammation, including IL-10, which inhibits IL-12 production.Formula:C379H606N114O101S13Purity:Min. 95%Molecular weight:8,792.43 g/molCyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt
CAS:Cyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt is a peptidomimetic that inhibits the growth of tumor cells by inhibiting angiogenesis, which is the formation of new blood vessels. It has been shown to effectively inhibit the proliferation of endothelial cells and decrease tumor vasculature in human ovarian carcinoma. Cyclo(-Arg-Ala-Asp-D-Phe-Lys) trifluoroacetate salt binds to cyclic peptides in the body and prevents them from being broken down by peptidases. This increases their uptake into cancer cells and inhibits angiogenesis, leading to a decrease in tumor size and number.Formula:C28H43N9O7Purity:Min. 95%Molecular weight:617.7 g/molAcetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt
CAS:Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu-NH2 trifluoroacetate salt is a prophylactic and/or therapeutic compound that has been shown to be effective in the treatment of a number of different diseases. This compound has been shown to have neuroprotective and antiinflammatory effects, as well as being an effective treatment for autoimmune disorders. Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu NH2 trifluoroacetate salt also has the potential to be used as a prophylactic or therapeutic agent against cancer, fibrotic disease, and inflammatory disease.Formula:C41H57N13O8Purity:Min. 95%Molecular weight:859.97 g/mol(S)-3-Amino-3-(4-chlorophenyl)-propan-1-ol
CAS:Please enquire for more information about (S)-3-Amino-3-(4-chlorophenyl)-propan-1-ol including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C9H12ClNOPurity:Min. 95%Molecular weight:185.65 g/molLQEQ-19 (mouse, rat) trifluoroacetate salt
CAS:Please enquire for more information about LQEQ-19 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C106H165N29O34Purity:Min. 95%Molecular weight:2,389.62 g/mol(p-Chloro-D-Phe6,Leu17)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:VIP is a potent vasoactive neuropeptide that is found in the heart, brain, and gut. It has been shown to be a potent inhibitor of guanethidine-induced contractions in the femoral vein, as well as atrial contractions. VIP also inhibits spontaneous contractions in the fundic region of the stomach and intestinal motility. VIP has been shown to inhibit vasoactive intestinal polypeptide-induced contractions in isolated rat ileum. VIP is expressed primarily in the enteric nervous system and throughout the gastrointestinal tract.Formula:C148H239ClN44O42Purity:Min. 95%Molecular weight:3,342.21 g/mol(D-Leu7)-LHRH trifluoroacetate salt
CAS:Please enquire for more information about (D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C55H75N17O13Purity:Min. 95%Molecular weight:1,182.29 g/molNeuropeptide F trifluoroacetate salt
CAS:Please enquire for more information about Neuropeptide F trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C210H328N58O58Purity:Min. 95%Molecular weight:4,593.21 g/molCathelicidin LL 37
CAS:LL-37 is a potent antimicrobial peptide that has been shown to be effective against cancer cells and is currently being investigated as a potential antineoplastic agent. LL-37 binds to the leukocyte receptor, which leads to chemotaxis, increased expression of p53 and apoptosis. LL-37 also induces apoptotic cell death in epithelial tissues, both in vitro and in vivo. This peptide has been shown to induce death in cancer cells, as well as cell death in other types of cells.Formula:C205H340N60O53Purity:Min. 95%Molecular weight:4,493.27 g/molN-Methyl-N-phenylcarbamoyl chloride
CAS:N-Methyl-N-phenylcarbamoyl chloride is a fluorinated compound that has been shown to be resistant to treatments with chlorides. It is used for kinetic studies of amines and other functional assays. Deuterium isotope effects have been observed in chloride ion binding experiments, which indicate that the molecule has a greater affinity for the chloride ion than does its non-deuterated counterpart.Formula:C8H8ClNOPurity:Min. 95%Color and Shape:PowderMolecular weight:169.61 g/molTridodecylmethylammonium chloride
CAS:Tridodecylmethylammonium chloride (TDMAC) is a biocompatible and non-toxic polymer that is used in the manufacture of sensors. TDMAC can be used as a coating on electrodes to increase their sensitivity to changes in pH and ionic strength. TDMAC is also used as a blood substitute, and has been shown to have anticoagulant properties. TDMAC has been shown to be effective at preventing heparin-induced thrombocytopenia when combined with dextran sulfate. This polymer has also been studied for use in biosensors and bioelectrochemical impedance spectroscopy devices.
Formula:C37H78ClNPurity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:572.47 g/mol5-Fluoro-2-nitroanisole
CAS:5-Fluoro-2-nitroanisole is an aminophenol that has potent inhibitory activity against lung cancer cells. This agent inhibits the growth of cancer cells by methylating the epidermal growth factor receptor (EGFR) and preventing its activation. 5-Fluoro-2-nitroanisole also inhibits the production of epidermal growth factor, which is a potent mitogen for skin cells. In vitro cytotoxic activity was observed when this compound was combined with heat or ultraviolet light.
Formula:C7H6FNO3Purity:Min. 95%Color and Shape:Light (Or Pale) Yellow To Tan To Grey SolidMolecular weight:171.13 g/molAmyloid Dan Protein (1-34) trifluoroacetate salt
CAS:Please enquire for more information about Amyloid Dan Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C185H268N48O51S2Purity:Min. 95%Molecular weight:4,044.53 g/molAminoguanidine hydrochloride
CAS:Aminoguanidine hydrochloride is a basic compound that can be used as an anti-inflammatory drug. It has been shown to have a hypoglycemic effect, which may be due to its ability to increase the activity of glutathione peroxidase and glutathione reductase in experimental models. Aminoguanidine hydrochloride also inhibits the production of inflammatory cytokines such as TNF-α, IL-1β and IL-6. Experiments with transfected cells have shown that aminoguanidine hydrochloride induces neuronal death, which may be due to its ability to inhibit protein synthesis by interfering with ribosomal function.Formula:CH6N4·HClPurity:Min. 95%Color and Shape:White PowderMolecular weight:110.55 g/molN-[2-[(2-Bromo-4,6-dinitrophenyl)azo]-5-(diethylamino)phenyl]acetamide
CAS:N-2-[(2-bromo-4,6-dinitrophenyl)azo]-5-(diethylamino)phenyl]acetamide (NBDPA) is a yellowish solid that is soluble in water. It has a molecular weight of 308.3 and chemical formula C14H21BrN2O4. NBDPA is used as an analytical reagent for the kinetic data of liver cells and in wastewater treatment. This compound has been shown to exhibit carcinogenic potential in rats, causing genetic damage to the DNA of liver cells and kidney tissue. NBDPA has also been shown to be toxic to fish embryos and larvae, with significant effects on the development of larvae at high concentrations.Formula:C18H19BrN6O5Purity:90%MinMolecular weight:479.28 g/molCholesteryl Bromide from Beef Fat
CAS:Controlled ProductCholesteryl Bromide from Beef Fat is a fatty acid that is extracted from beef fat. It is used in the production of polymeric matrices for the treatment of radiation burns, skin ulcers, and pressure sores. Cholesteryl Bromide from Beef Fat has been shown to be effective in inhibiting the growth of skin cells when applied topically. It also has been shown to inhibit the growth of cancer cells in vitro and inhibit tumor formation in mice. This fatty acid also has been found to have a role as a biological function by stimulating cell proliferation and being involved in lipid metabolism. It also is an aliphatic hydrocarbon with a group p2 structure that can be converted into cholesteryl erucate through hydrochloric acid.Formula:C27H45BrPurity:Min. 95%Color and Shape:PowderMolecular weight:449.55 g/molAnantin (linear sequence) trifluoroacetate salt
CAS:Please enquire for more information about Anantin (linear sequence) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C90H113N21O25Purity:Min. 95%Molecular weight:1,888.99 g/molImidazole trifluoromethanesulfonate
CAS:Imidazole trifluoromethanesulfonate is a compound that has been used as an ingredient in deionized water. It is also used to treat cardiovascular disorders, psychotic disorders, and metabolic disorders. Imidazole trifluoromethanesulfonate has been shown to reduce the production of hydrogen peroxide in the brain and prevent oxidative damage to DNA. This drug prevents the synthesis of imidazoline, which may be responsible for its effects on blood pressure and heart rate. Imidazole trifluoromethanesulfonate is metabolized by cytochrome P450 enzymes into a protonated form that can bind to viral polymerase and inhibit DNA synthesis. The drug also inhibits hepatitis B virus replication by binding to the NS5B polymerase protein essential for viral RNA synthesis.Formula:C4H5F3N2O3SPurity:Min. 95%Color and Shape:PowderMolecular weight:218.16 g/mol5-Bromoquinolin-6-amine
CAS:Please enquire for more information about 5-Bromoquinolin-6-amine including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C9H7BrN2Purity:Min. 95%Molecular weight:223.07 g/mol2-Fluoro-6-(trifluoroMethyl)pyridine-3-boronic acid
CAS:Please enquire for more information about 2-Fluoro-6-(trifluoroMethyl)pyridine-3-boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C6H4BF4NO2Purity:Min. 95%Molecular weight:208.91 g/molBexagliflozin
CAS:Bexagliflozin is a drug that is used to treat type II diabetes in adults. It helps to control blood sugar levels by inhibiting the enzyme DPP-IV and increasing insulin release from the pancreas. Bexagliflozin has been shown to be effective in lowering blood sugar levels in patients with chronic kidney disease and cancer, as well as those with a body mass index (BMI) of 30 or higher. This drug is an oral hypoglycaemic agent that can be used for diagnostic purposes. It has also been shown to be clinically effective for the treatment of diabetic nephropathy and diabetic retinopathy. The enantiomers of bexagliflozin can be differentiated according to their pharmacological properties, which may allow for more targeted therapy.Formula:C24H29ClO7Purity:Min. 95%Molecular weight:464.94 g/molZ-Asp-Glu-Val-Asp-chloromethylketone
CAS:Z-Asp-Glu-Val-Asp-chloromethylketone is a reactive compound that inhibits the activity of proteases and induces neuronal death. Z-Asp-Glu-Val-Asp-chloromethylketone has been shown to induce necrotic cell death in malignant brain cells and has neurotrophic properties. It also causes mitochondrial membrane depolarization, which leads to mitochondrial cytochrome c release and subsequent apoptosis. The reaction mechanism is still unclear but it may involve hydrogen bonding between the ketone group and the amide nitrogen atom of the aspartate residue.Formula:C27H35ClN4O12Purity:Min. 95%Molecular weight:643.04 g/molSPLUNC1 (22-39) trifluoroacetate salt
CAS:Please enquire for more information about SPLUNC1 (22-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C82H135N21O25Purity:Min. 95%Molecular weight:1,815.08 g/mol2,7-Bis[2-(diethylamino)ethoxy]-9-fluorenone dihydrochloride
CAS:Controlled Product2,7-Bis[2-(diethylamino)ethoxy]-9-fluorenone dihydrochloride (2,7-BDFE) is a potent inducer of interferon. It is a natural compound that has been shown to have significant cytotoxicity against murine sarcoma virus and opportunistic fungal infections. 2,7-BDFE has also been shown to induce toll-like receptor 4 (TLR4), which triggers the production of other cytokines and chemokines. 2,7-BDFE has also been found to inhibit the growth of cancer cells in vitro and in vivo. This drug is used as an inhibitor for benzalkonium chloride for the prevention of bacterial contamination on surfaces.Formula:C25H36N2O3Cl2Purity:Min. 95%Color and Shape:Yellow PowderMolecular weight:483.47 g/mol6-Hydroxy chlorzoxazone
CAS:6-Hydroxy chlorzoxazone is a drug that interacts with 5-hydroxy omeprazole, cytochrome P450 (CYP2E1), and chlorzoxazone. This drug is not metabolized by CYP2E1, but is metabolized by liver microsomes. The plasma concentration of 6-hydroxy chlorzoxazone increases as the patient's body mass index increases. It has been shown to affect the activity of hepatic enzymes such as CYP2E1 and p450 in rat liver microsomes. 6-Hydroxy chlorzoxazone may be used for the treatment of bronchial asthma and chronic obstructive pulmonary disease. The kinetic data for 6-hydroxy chlorzoxazone are based on studies done on humans and rats.Formula:C7H4ClNO3Purity:(%) Min. 95%Color and Shape:Beige PowderMolecular weight:185.56 g/mol(D-Arg0, Hyp 3,Igl5,D-Igl7, Oic 8)-Bradykinin trifluoroacetate salt
CAS:Please enquire for more information about (D-Arg0, Hyp 3,Igl5,D-Igl7, Oic 8)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C64H95N19O13Purity:Min. 95%Molecular weight:1,338.56 g/molTetraethylammonium bromide
CAS:Tetraethylammonium bromide is an ionic liquid that has a low viscosity and high water solubility. It is used as an antimicrobial agent in the process of producing polymers, such as polyurethane. Tetraethylammonium bromide has been shown to be effective against a broad range of bacteria, including Bacillus subtilis and Escherichia coli. It has also been shown to have a protective effect on neurons by preventing neuronal death in response to oxidative stress. This protection may be due to its ability to increase the concentration of cytosolic Ca2+ ions, which are involved in neuronal survival pathways.
Formula:C8H20BrNPurity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:210.16 g/molAngiotensin A trifluoroacetate salt
CAS:Angiotensin A trifluoroacetate salt H-Ala-Arg-Val-Tyr-Ile-His-Pro-Phe-OH is a drug that has been shown to be effective in treating chronic kidney disease and heart failure. It is a synthetic peptide that mimics the activity of angiotensin II, an important regulator of blood pressure. Angiotensin A trifluoroacetate salt H-Ala-Arg-Val-Tyr-Ile-His-Pro-Phe-OH binds to the angiotensin receptor, which causes vasoconstriction and increases the release of soluble guanylate cyclase. This drug also inhibits the production of matrix metalloproteinases, which break down collagen and other extracellular proteins.Formula:C49H71N13O10Purity:Min. 95%Molecular weight:1,002.17 g/mol(Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt
CAS:Please enquire for more information about (Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C141H233N45O42Purity:Min. 95%Molecular weight:3,230.64 g/mol5-Chlorouracil
CAS:5-Chlorouracil is a drug that is used to treat cancer. It has been shown to have biological properties, and its mechanism of action is not yet fully understood. 5-Chlorouracil can be synthesized in the laboratory by reacting sodium hydroxide with 5-chloro-2,4(1H,3H)-pyrimidinedione. In wastewater treatment plants, it reacts with organic matter in the water to form nontoxic products, such as carbon dioxide and urea. The reaction solution contains 5-chlorouracil, which undergoes tautomerization spontaneously or through the addition of base. This reaction is reversible, and both the erythro and threo forms are present in solution at equilibrium. The biological properties of 5-chlorouracil have been investigated using sublethal doses in experimental animals. In one study, 5-chlorouracil was found to inhibit xanthine oxidase activity in rats significantly moreFormula:C4H3ClN2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:146.53 g/molZ-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt
CAS:Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt is a proteolytic enzyme that has been shown to have bone resorption and tissue destructive properties. It is active against porphyromonas and bactericidal against fibrinogen. Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt also inhibits the formation of osteoclasts by inhibiting the uptake and protease activity of extracellular matrix proteins such as fibrinogen. This drug is currently being researched for possible use in the treatment of Alzheimer's Disease.Formula:C34H41N3O6Purity:Min. 95%Molecular weight:587.71 g/mol(Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt
CAS:Please enquire for more information about (Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C64H107N25O19S2Purity:Min. 95%Molecular weight:1,594.82 g/mol(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt
CAS:(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt H-Ala-Ser-Ala-Ser-Ser-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu) is a phorbol ester, which is an analog of endothelin. It has been shown to inhibit the production of proinflammatory cytokines and chemokines in vitro and in vivo. This compound also inhibits the migration and proliferation of vascular endothelial cells, which may be due to its ability to suppress Ca2+ concentration. (Ala1·3·11·15)-Endothelin -1 trifluoroacetate salt H-) can also be used as a fluorescent marker for immunohistochemical studies on tissues such as vessels and gastrointestinal tissues. The localization of this drug can be observed by microscopy techniques such as
Formula:C109H163N25O32SPurity:Min. 95%Molecular weight:2,367.68 g/mol(Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS:Please enquire for more information about (Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C43H69N9O11SPurity:Min. 95%Molecular weight:920.13 g/molDL-Alanine ethyl ester hydrochloride
CAS:DL-Alanine ethyl ester hydrochloride is a byproduct of the reaction between ethylene and amines. It can be produced through the addition of l-phenylalanine to acetonitrile. This compound is an organic ester that has been shown to have a variety of reactions with metal ions, such as aluminium, l-glutamic acid, and primary amines. The product can be used in thermodynamic data for reaction systems involving DL-alanine ethyl ester hydrochloride.
Formula:C5H11NO2·HClPurity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:153.61 g/molAlpha-Conotoxin MI trifluoroacetate salt
CAS:Controlled ProductA component of Conus venom; antagonist of nicotinic acetylcholine receptorsFormula:C58H88N22O17S4Purity:Min. 95%Molecular weight:1,493.72 g/molPancreastatin (33-48) (human) trifluoroacetate salt
CAS:Pancreastatin (33-48) is a synthetic, acidic, sulfated peptide that has been shown to have high activity against pancreatic cancer cells. Pancreastatin (33-48) has been synthesized by reacting an oligopeptide with glutamic acid and aspartic acid. The N-terminal of this peptide is amidated and contains a sulfate group. This molecule has been purified by SDS-polyacrylamide gel electrophoresis and the sulfate fractionation method. Pancreastatin (33-48) is able to inhibit the proliferation of pancreatic tumor cells in vitro, but it does not appear to be cytotoxic to normal pancreatic cells. In addition, pancreastatin (33-48) has also been shown to decrease tumor growth in vivo in mice bearing a transplanted human pancreatic tumor.Formula:C78H123N21O27SPurity:Min. 95%Molecular weight:1,819 g/mol(Val5)-Angiotensin I trifluoroacetate salt
CAS:Angiotensin I is a peptide that belongs to the class of substances called angiotensins. This substance is found in many tissues and organs, including the brain, adrenal gland, and lung. Angiotensin I has been shown to be a pressor agent and also has biochemical effects on amino acid composition. The c-terminal sequence of this substance has been determined by incubating the molecule with pepsin at different pH values. The molecular weight of this substance is 938 Da and it has an amino acid composition of Asp-Arg-Val-Tyr-Val-His-Pro-Phe-His-Leu.Formula:C61H87N17O14Purity:Min. 95%Molecular weight:1,282.45 g/mol4-Amino-3,5,6-trichloropyridine-2-carboxylic acid
CAS:4-Amino-3,5,6-trichloropyridine-2-carboxylic acid (4ATC) is a herbicide that inhibits the activity of pyridoxal phosphate (PLP)-dependent enzymes. 4ATC has been shown to be more toxic to plants than temozolomide and is used in vitro to study the effects of herbicides on cells. It inhibits cell growth and induces apoptosis in human cancer cells. In addition, 4ATC has been shown to inhibit the enzyme activities of group P2 proteins and nucleic acid synthesis. 4ATC also inhibits protein synthesis by inhibiting RNA synthesis in eukaryotic cells. 4ATC is not active against bacteria or fungi.Formula:C6H3Cl3N2O2Purity:Min. 95%Color and Shape:White To Tan SolidMolecular weight:241.46 g/mol(His(1-Me)2)-LHRH trifluoroacetate salt
CAS:Please enquire for more information about (His(1-Me)2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C56H77N17O13Purity:Min. 95%Molecular weight:1,196.32 g/mol2-(Difluoromethoxy)Phenol
CAS:2-(Difluoromethoxy)Phenol is a purine derivative and pyrimidine derivative. It has been shown to inhibit the growth of cancer cells in vitro and in vivo. 2-(Difluoromethoxy)phenol inhibits multidrug resistance by inhibiting the transport of drugs into cells and thereby preventing their accumulation. As a result, it suppresses inflammatory diseases and autoimmune diseases. The hydroxyl group in this compound can be replaced with fluorine or nitro groups to generate new derivatives with different properties. Piperidine can also be added to this molecule to create an analogue that is more potent than 2-(difluoromethoxy)phenol and has a longer duration of action.Formula:C7H6F2O2Purity:Min. 95%Molecular weight:160.12 g/mol8-Quinolinesulfonyl chloride
CAS:8-Quinolinesulfonyl chloride (8QSC) is a quinoline derivative that has been shown to have anticancer activity. 8QSC binds to the receptor site of cells and inhibits the production of amines, which are important for cell growth and proliferation. It also binds to hydrogen bonds, which may be involved in the cytotoxicity observed in pancreatic cancer cells. 8QSC shows significant cytotoxicity against Panc-1 cells, but not against NIH 3T3 cells. This may be due to its ability to form supramolecular aggregates with copper ions and quinoline derivatives.Purity:Min. 95%(Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt
CAS:Please enquire for more information about (Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C156H244N48O40S2Purity:Min. 95%Molecular weight:3,496.04 g/mol(Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH trifluoroacetate salt
CAS:Please enquire for more information about (Des-Gly10,D-Ser(tBu)6,Pro-NHNH29)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C58H83N17O13Purity:Min. 95%Molecular weight:1,226.39 g/molAc-Val-Glu-His-Asp-AFC trifluoroacetate salt
CAS:Please enquire for more information about Ac-Val-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C32H36F3N7O11Purity:Min. 95%Molecular weight:751.66 g/molAngiotensin (1-12) (human) trifluoroacetate salt
CAS:Please enquire for more information about Angiotensin (1-12) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C73H109N19O16Purity:Min. 95%Molecular weight:1,508.77 g/molScandium(III)chloride hexahydrate
CAS:Scandium(III)chloride is an inorganic chemical that is soluble in water and has a high affinity for urine. Scandium(III)chloride is used to measure the uptake of lanthanum, inorganic metals, and organic acids in urine samples. It can also be used to measure the chloride content of urine. Scandium(III)chloride reacts with acids or alkene compounds to form an ionic compound that can be determined by spectrophotometry. The reaction rate depends on the glomerular filtration rate (GFR).Formula:Cl3ScPurity:Min. 95%Molecular weight:151.31 g/mol1-(4-Chlorothiophen-2-yl)ethanone
CAS:1-(4-Chlorothiophen-2-yl)ethanone is an oxychloride that belongs to the family of thiourea derivatives. It is synthesized by reacting phosphorus oxychloride with 2,3-dichloroacetophenone in a solvent such as dioxane or acetonitrile. The final product is purified by means of vacuum distillation and recrystallization from diethyl ether, hexane, and chlorinated hydrocarbons.Formula:C6H5ClOSPurity:Min. 95%Molecular weight:160.62 g/molDefensin HNP-3 (human) trifluoroacetate salt
CAS:HNP-3Formula:C151H222N44O40S6Purity:Min. 95%Molecular weight:3,486.05 g/mol(R)-2-Methylmorpholine hydrochloride
CAS:Please enquire for more information about (R)-2-Methylmorpholine hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C5H12ClNOPurity:Min. 95%Molecular weight:137.61 g/molH-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond)
CAS:Please enquire for more information about H-Tyr-Cys-Trp-Ser-Gln-Tyr-Leu-Cys-Tyr-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C58H71N11O15S2Purity:Min. 95%Molecular weight:1,226.38 g/mol4-Chlorophenethyl alcohol
CAS:4-Chlorophenethyl alcohol is a synthetic, primary alcohol. It can be synthesized by reacting 2,4-dichlorobenzoic acid with a Grignard reagent. The reaction produces 4-chlorophenethyl alcohol, which is insoluble in water and reacts with chloride to form chloroform. This procedure can be used to produce other chlorinated alcohols. 4-Chlorophenethyl alcohol has been shown to have acute toxicities that are similar to those of trifluoroacetic acid and it is believed that the toxicity is due to its ability to react with proteins and nucleic acids.Formula:C8H9ClOPurity:Min. 95%Color and Shape:PowderMolecular weight:156.61 g/molL-Cystine dihydrochloride
CAS:L-Cystine dihydrochloride is a chemical compound that is used as an amino acid. It has biological properties that are due to its ability to inhibit pancreatic lipase and l-threonine. L-Cystine dihydrochloride has been shown to have anti-infectious effects against a number of bacterial and viral diseases, including HIV, herpes simplex virus, and influenza. L-Cystine dihydrochloride is also used in cell culture experiments because it can be used to break disulfide bonds in proteins.Formula:C6H14Cl2N2O4S2Purity:Min. 95%Color and Shape:White PowderMolecular weight:313.22 g/mol...(Ala13)-Apelin-13 (human, bovine, mouse, rat) trifluoroacetate salt
CAS:Apelin-13 is a peptide hormone that is involved in the regulation of cardiovascular, respiratory and gastrointestinal functions. It has been shown to stimulate receptor activity and pain sensitivity in animal models. Apelin-13 has been shown to act as an opioid receptor agonist, meaning that it binds to the opioid receptors and activates them. This activation leads to an increase in the production of growth factors and matrix metalloproteinases, which are proteins that break down collagen and other substances in the body. The increased production of these substances can lead to inflammation and tissue destruction. Apelin-13 also interacts with several other receptors including CB2 (a cannabinoid receptor), GPCR (a G protein-coupled receptor), CRHR1 (a corticotropin releasing hormone receptor 1) and Naloxone (an opioid antagonist).
Formula:C63H107N23O16S·xC2HF3O2Purity:Min. 95%Molecular weight:1,474.74 g/molH-2,6-Difluoro-Phe-OH·HCl
CAS:Please enquire for more information about H-2,6-Difluoro-Phe-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C9H9F2NO2·HClPurity:Min. 95%Molecular weight:237.63 g/molH-Cys(Trt)-2-chlorotrityl resin (100-200 mesh)
Please enquire for more information about H-Cys(Trt)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%4-Amino-6-chloro-1,3-benzenedisulfonamide
CAS:4-Amino-6-chloro-1,3-benzenedisulfonamide is a natural substance that has been used in Chinese medicine preparations for the treatment of cardiac problems. It belongs to the class of organic compounds called benzenedisulfonamides. 4-Amino-6-chloro-1,3-benzenedisulfonamide is produced by the bacterial enzyme aminase from amino acid and benzoic acid. The adsorption mechanism of 4-Amino-6-chloro-1,3-benzenedisulfonamide is not fully understood, but it is believed that the benzyl groups are key players in this process. The high affinity of 4-Amino-6-chloro1,3 benzenedisulfonamide to proteins may be due to its ability to form hydrogen bonds with protein side chains, such as serine or threonine residues. 4 AminoFormula:C6H8ClN3O4S2Purity:Min. 95%Color and Shape:White To Light Brown SolidMolecular weight:285.73 g/molBoc-Lys(2-chloro-Z)-PAM resin (200-400 mesh)
Please enquire for more information about Boc-Lys(2-chloro-Z)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid
CAS:2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid is a fine chemical that is used in research and as a reagent. It is also used as a building block for more complex compounds and as a versatile scaffold in organic synthesis. 2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid can be reacted with other chemicals to create new compounds. This chemical has been shown to have antihistamine properties and may also function as an antipsychotic drug.Formula:C9H6BrNO5Purity:Min. 95%Molecular weight:288.05 g/mol(3,5-Diiodo-Tyr1,D-Ala2,N-Me-Phe4,glycinol5)-Enkephalin acetate salt
CAS:Controlled ProductPlease enquire for more information about (3,5-Diiodo-Tyr1,D-Ala2,N-Me-Phe4,glycinol5)-Enkephalin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C26H33I2N5O6Purity:Min. 95%Molecular weight:765.38 g/molBis(4-chlorophenyl)sulfone
CAS:Bis(4-chlorophenyl)sulfone is a chemical compound that has been shown to have high water permeability. It is a white solid at room temperature and can be dissolved in trifluoroacetic acid, hydrochloric acid, and sodium carbonate. Bis(4-chlorophenyl)sulfone has been shown to react with diphenyl sulfoxide, giving the corresponding sulfoxide. Bis(4-chlorophenyl)sulfone can undergo chemical reactions with other compounds to form new chemical compounds. This property makes it an excellent starting material for synthesizing new drugs. Bis(4-chlorophenyl)sulfone does not cause carcinogenesis in mice when administered orally for up to 12 months at concentrations of 1 ppm or higher.Formula:C12H8Cl2O2SPurity:Min. 95%Color and Shape:SolidMolecular weight:287.16 g/molChloramine T trihydrate
CAS:Chloramine T trihydrate is a water-soluble and biodegradable chemical that is used in wastewater treatment. It reacts with chloramines to produce chloramine, which has a higher disinfectant potential than chlorine. Chloramine T trihydrate also has antimicrobial properties and can be used to control microbial growth in biological samples. In addition, it can inhibit the activity of certain enzymes, such as aziridination, which is involved in the production of nitrosamines and nitric oxide. The matrix effect for chloramine-t may be different from other antimicrobial agents because it does not have a high affinity for proteins. It was found that benzalkonium chloride had an inhibitory effect on chloramine-t activity. MECHANISM OF ACTION: Chloramine T trihydrate is an oxidizing agent that reacts with organic matter to form chloramines and other oxidized products. When these reactions occur in the presence of water or organic material,Formula:C7H7ClNNaO2S•(H2O)3Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:282.7 g/molBiotinyl-LL-37 amide trifluoroacetate salt
CAS:Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C215H355N63O54SPurity:Min. 95%Molecular weight:4,718.58 g/molAc-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt
CAS:Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.Formula:C23H34N6O9Purity:Min. 95%Molecular weight:538.55 g/molHeat Shock Protein (hsp) Fragment trifluoroacetate salt
CAS:Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C63H113N22O25PSPurity:Min. 95%Molecular weight:1,641.74 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C195H300N56O56SPurity:Min. 95%Molecular weight:4,356.88 g/mol(Glu17·21·24)-Osteocalcin (1-49) (human) trifluoroacetate salt
Please enquire for more information about (Glu17·21·24)-Osteocalcin (1-49) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C266H381N67O76S2Purity:Min. 95%Molecular weight:5,797.41 g/mol(His(3-Me)2)-LHRH trifluoroacetate salt
CAS:Please enquire for more information about (His(3-Me)2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C56H77N17O13·C2HF3O2Purity:Min. 95%Molecular weight:1,310.34 g/mol1-Benzyl-4-bromo-1H-pyrazole
CAS:1-Benzyl-4-bromo-1H-pyrazole is a pyrazole derivative that can be synthesized from 1,2,3-triazoles and bromine. It undergoes arylation reactions in the presence of copper to form aryl derivatives. It is also catalytic mediated with alkyl halides to form c–h bond cleavage products. This compound reacts with tribromide to form an alkylation product. The ligand is activated by arylations and alkylations. It is used as a reagent in organic chemistry for the synthesis of pyrazole derivatives.Formula:C10H9BrN2Purity:Min. 95%Molecular weight:237.1 g/molAcetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt
CAS:Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C116H176N26O30S2Purity:Min. 95%Molecular weight:2,478.93 g/moltert-Butyl 7-bromo-3,4-dihydroisoquinoline-2(1H)-carboxylate
CAS:Please enquire for more information about tert-Butyl 7-bromo-3,4-dihydroisoquinoline-2(1H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C14H18BrNO2Purity:Min. 95%Color and Shape:PowderMolecular weight:312.2 g/molSarafotoxin B trifluoroacetate salt
CAS:Component of snake venom; part of a family of vasoconstrictor isopeptidesFormula:C110H159N27O34S5Purity:Min. 95%Molecular weight:2,563.93 g/molMethyl 5-bromo-2-nitrobenzoate
CAS:Please enquire for more information about Methyl 5-bromo-2-nitrobenzoate including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt
CAS:Please enquire for more information about Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C104H146N24O23SPurity:Min. 95%Molecular weight:2,132.49 g/mol(Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS:Please enquire for more information about (Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C47H74N10O14SPurity:Min. 95%Molecular weight:1,035.22 g/mol(Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt
Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C134H180N34O26S2Purity:Min. 95%Molecular weight:2,747.21 g/molThymosin alpha1 trifluoroacetate salt
CAS:Please enquire for more information about Thymosin alpha1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C129H215N33O55·xC2HF3O2Purity:Min. 95%Molecular weight:3,108.28 g/molPACAP-27 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:Trifluoroacetate saltFormula:C142H224N40O39SPurity:Min. 95%Molecular weight:3,147.61 g/mol(S)-3,3'-Dibromo-5,5',6,6',7,7',8,8'-octahydro-1,1'-binaphthalene-2,2'-diol
CAS:(S)-3,3'-Dibromo-5,5',6,6',7,7',8,8'-octahydro-1,1'-binaphthalene-2,2'-diol is a synthetic compound that has been prepared by a Diels-Alder reaction. It is used as an asymmetric synthesis catalyst for the production of optically active compounds. The ligands are catalysts for the reaction and can be easily replaced with different ligands to produce different products. This compound has been researched for its potential use in the production of pharmaceuticals and other chemicals.Formula:C20H20Br2O2Purity:Min. 95%Color and Shape:White To Yellow SolidMolecular weight:452.18 g/mol4-((5-Bromopyridin-2-yl)amino)-4-oxobutanoic acid
CAS:4-((5-Bromopyridin-2-yl)amino)-4-oxobutanoic acid (BABA) is a potent photosynthetic inhibitor that inhibits light-driven electron transport in chloroplasts. This inhibition of electron transport leads to the accumulation of reactive oxygen species and cellular dysfunction. BABA is used to induce dormancy in plants and is also used as a chemical inhibitor for arabidopsis thaliana, a type of plant commonly used in molecular biology research. Studies have shown that BABA inhibits the growth of fat cells, which may be due to its ability to inhibit protein synthesis, leading to decreased fat deposition. In addition, this drug has been shown to reduce eye disorders such as retinal degeneration and cataracts by inhibiting the production of reactive oxygen species, which causes oxidative stress.Formula:C9H9BrN2O3Purity:(Elemental Analysis) Min. 97%Color and Shape:PowderMolecular weight:273.08 g/molHIV-1 tat Protein (49-57) trifluoroacetate salt
CAS:Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C53H106N30O11Purity:Min. 95%Molecular weight:1,339.6 g/mol4-Epianhydrotetracycline hydrochloride hydrate
CAS:4-Epianhydrotetracycline hydrochloride hydrate is a chemical compound that inhibits the activation of protein kinase C (PKC) and blocks the apoptosis pathway. It has been shown to induce apoptosis in prostate cancer cells and also inhibits the proliferation of human microvessel endothelial cells. 4-Epianhydrotetracycline hydrochloride hydrate is stable in both human serum and wastewater, which makes it an ideal drug for treating many types of cancers. It is also used in pharmaceutical drugs as a cytochalasin, which are used to treat angina pectoris by reducing oxygen uptake by erythrocytes, thereby inhibiting oxidative phosphorylation. 4-Epianhydrotetracycline hydrochloride hydrate prevents mitochondrial cytochrome c release, thus blocking the apoptotic pathway in cells. This chemical compound may act as a regulatory molecule that affects energy metabolism and epidermal growth factor (EGF)Formula:C22H23ClN2O7Purity:Min. 95%Molecular weight:462.88 g/molPrion Protein (106-126) (human) (scrambled) trifluoroacetate salt
CAS:Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C80H138N26O24S2Purity:Min. 95%Molecular weight:1,912.24 g/molEndothelin-1 (11-21) trifluoroacetate salt
CAS:Endothelin-1 (11-21) trifluoroacetate salt H-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp is a peptide that is derived from endothelin. It has been shown to have an inhibitory effect on insulin stimulated glucose uptake in Sprague Dawley rats. This peptide has also been shown to bind to the endothelin receptor and act as a nonselective agonist. Endothelin 1 (11–21) trifluoroacetate salt H-Cys Val Tyr Phe Cys His Leu Asp Ile Ile Trp, when incubated with cells, had a maximal response at micron concentrations.Formula:C68H92N14O15S2Purity:Min. 95%Molecular weight:1,409.68 g/molGastric Inhibitory Polypeptide (6-30) amide (human) trifluoroacetate salt
CAS:Please enquire for more information about Gastric Inhibitory Polypeptide (6-30) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C139H209N35O38SPurity:Min. 95%Molecular weight:3,010.43 g/molAnti-Kentsin trifluoroacetate salt
CAS:Please enquire for more information about Anti-Kentsin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C22H45N11O6Purity:Min. 95%Molecular weight:559.66 g/mol(alphaR)-alpha-[[[2-(4-Nitrophenyl)ethyl]amino]methyl]benzenemethanol hydrochloride
CAS:Intermediate in the synthesis of mirabegron
Formula:C16H18N2O3·HClPurity:Min. 95%Molecular weight:322.79 g/mol5,6,7,7a-Tetrahydrothieno[3,2-c]pyridinone hydrochloride
CAS:5,6,7,7a-Tetrahydrothieno[3,2-c]pyridinone hydrochloride is a ketone with the chemical formula of C5H5NO2. It has been synthesized by acetylation of 5,6-dihydro-1,4-thieno[3,2-c]pyridinone in solvents and alkali. The reaction product has a melting point of 116–118 degrees Celsius. 5,6,7,7a-Tetrahydrothieno[3,2-c]pyridinone hydrochloride is used as a target compound for synthesis of prasugrel. Prasugrel is an antiplatelet drug that works by inhibiting the enzyme ADP P2Y 12 . This inhibition prevents activation of platelets and reduces platelet aggregation. The reactants toluene and chlorine were used inFormula:C7H10ClNOSPurity:Min. 97 Area-%Color and Shape:PowderMolecular weight:191.68 g/molGRF (bovine) trifluoroacetate salt
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molIntermedin-53 (human) trifluoroacetate salt
Please enquire for more information about Intermedin-53 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C247H395N83O73S3Purity:Min. 95%Molecular weight:5,791.49 g/molGalnon trifluoroacetate salt
CAS:Galnon trifluoroacetate salt is a pharmacological agent that binds to galanin and inhibits its binding to G protein-coupled receptors. It was shown to have a cancer preventive effect on 3T3-L1 preadipocytes by inhibiting the production of the inflammatory cytokine, tumor necrosis factor-α (TNF-α). Galnon trifluoroacetate salt also has an effect on the immune system and may be used as an anti-inflammatory agent in autoimmune diseases. This drug has been shown to block the effects of galanin on camp levels, leading to a decrease in locomotor activity.
Formula:C40H46N4O6Purity:Min. 95%Molecular weight:678.82 g/mol2-(1,3-Benzodioxol-5-yl)-4,6-bis(trichloromethyl)-1,3,5-triazine
CAS:2-(1,3-Benzodioxol-5-yl)-4,6-bis(trichloromethyl)-1,3,5-triazine is a triazine compound that contains a hydroxyl group and a carboxylic acid. It is used as a polymerization initiator for cationic polymerization. 2-(1,3-Benzodioxol-5-yl)-4,6-bis(trichloromethyl)-1,3,5-triazine is also used as a chemical treatment for water supplies and wastewater. This compound can absorb many organic compounds that are harmful to the environment such as pesticides and herbicides. 2-(1,3-Benzodioxol-5-yl)-4,6-bis(trichloromethyl)-1,3,5-triazine has been shown to function as an antiinflammatory agent through its hydrogen bonding properties.Purity:Min. 95%2-(2-Bromoethyl)-1,3-dioxolane
CAS:2-(2-Bromoethyl)-1,3-dioxolane is a synthetic chemical compound that is used for the asymmetric synthesis of fatty acids. It can be prepared by the cross-coupling reaction of ethyl formate with bromoethane and copper(II) acetate in trifluoroacetic acid. The reaction produces an unsymmetrical product with two aldehyde groups and two halides on each side of the molecule. It can also be prepared by the reaction of 2-bromoethanol with sodium formaldehyde sulfoxylate and sodium methoxide in methanol. This process produces a symmetrical molecule with one aldehyde group on each side of the molecule. 2-(2-Bromoethyl)-1,3-dioxolane has been shown to have anti-cancer properties in carcinoma cell lines.Formula:C5H9BrO2Purity:Min. 95%Color and Shape:Brown Colorless Yellow Clear LiquidMolecular weight:181.03 g/molCys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS:Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C112H176N38O22S3Purity:Min. 95%Molecular weight:2,503.04 g/molH-Cys-psi(CH2NH)Val-psi(CH2NH)Phe-Met-OH trifluoroacetate salt
CAS:FTI-277 is a peptidomimetic compound that inhibits HIV-1 protease. FTI-277 is an orally active, potent, and selective inhibitor of HIV-1 protease. The drug has been shown to be effective in the treatment of HIV infection in various clinical trials. FTI-277 inhibited HIV replication in activated cells and disrupted virion production by binding to the target enzyme. FTI-277 also has potential for use as a diagnostic tool for detecting the presence of HIV in body fluids.Formula:C22H38N4O3S2Purity:Min. 95%Molecular weight:470.69 g/mol2,4,6-Trifluorobenzoic acid
CAS:2,4,6-Trifluorobenzoic acid is a chemical compound that is an intermediate in the synthesis of stilbazole. It is prepared by chlorinating the 2,4,6-trichlorobenzoic acid with hydrogen peroxide and hydrochloric acid. The 2,4,6-trifluorobenzoic acid is then reduced to the desired product with sodium borohydride. This chemical has been detected in nature as a racemic mixture and can be used as a precursor in analytical methods for detecting other compounds. It is also used in dechlorination reactions to remove chlorine from organic molecules. This process can be monitored using UV detectors.Formula:C7H3F3O2Purity:Min. 95%Molecular weight:176.09 g/molH-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt
CAS:H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt is a casein that is used as a model system for pancreatic β-cells. It has been shown to induce cell apoptosis in malignant cells and sequences that are associated with the development of pancreatic cancer. H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt also induces endothelial cell proliferation and decreases cell function, which may be due to its ability to promote uptake of this compound.Formula:C15H23N3O10Purity:Min. 95%Molecular weight:405.36 g/molBig Endothelin-1 (1-31) (human, bovine) trifluoroacetate salt )
CAS:Please enquire for more information about Big Endothelin-1 (1-31) (human, bovine) trifluoroacetate salt ) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C162H236N38O47S5Purity:Min. 95%Molecular weight:3,628.17 g/molPep-1-cysteamide trifluoroacetate salt
CAS:Please enquire for more information about Pep-1-cysteamide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C140H202N36O33SPurity:Min. 95%Molecular weight:2,949.39 g/molMART-1 (27-35) (human) trifluoroacetate salt
CAS:Controlled ProductPlease enquire for more information about MART-1 (27-35) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C37H67N9O11Purity:Min. 95%Molecular weight:813.98 g/molMethyl 6-bromo-1,2-dihydro-2-oxo-4-pyridineacetate
CAS:Please enquire for more information about Methyl 6-bromo-1,2-dihydro-2-oxo-4-pyridineacetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C8H8BrNO3Purity:Min. 95%Molecular weight:246.06 g/molCell-permeable Caspase-1 Inhibitor I trifluoroacetate salt
CAS:Please enquire for more information about Cell-permeable Caspase-1 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C97H160N20O24Purity:Min. 95%Molecular weight:1,990.43 g/molEndothelin-3 (human, mouse, rabbit, rat) trifluoroacetate salt
CAS:Trifluoroacetate saltFormula:C121H168N26O33S4Purity:Min. 95%Molecular weight:2,643.05 g/mol(D-Trp8)-gamma2-MSH trifluoroacetate salt
CAS:Please enquire for more information about (D-Trp8)-gamma2-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C74H99N21O16SPurity:Min. 95%Molecular weight:1,570.78 g/mol1,4-Bis-(bromoacetoxy)-2-butene
CAS:1,4-Bis-(bromoacetoxy)-2-butene is a cationic surfactant that has been shown to have microbicidal activity. It is synthesized by the reaction of 1,4-dibromobutane and acetyl bromide in an activated state. This compound can be used as a disinfectant for blood and other bodily fluids. 1,4-Bis-(bromoacetoxy)-2-butene can also be used to remove cholesterol from the surface of cells in the human body and is often used as a hybridization reagent for specific antibodies. The compound binds to the erythrocyte membrane, which may cause cell lysis. The compound has been shown to have synergistic effects when combined with chlorides such as sodium chloride or potassium chloride. 1,4-Bis-(bromoacetoxy)-2-butene has also been found to bind specifically to both A and B blood
Formula:C8H10Br2O4Purity:Min. 95%Molecular weight:329.97 g/mol2-Bromo-2'-chlorophenyl acetic acid methyl ester
CAS:2-Bromo-2'-chlorophenyl acetic acid methyl ester is a synthetic chemical that can be used as a pharmaceutical intermediate. It is prepared by the reaction of bromine with 2-chloroacetic acid and magnesium, which yields the desired product. The catalytic effect of this chemical is due to its ability to act as a catalyst for many reactions, such as the synthesis of clopidogrel. This chemical also has an industrial application in the production of other medicines, such as aspirin.Formula:C9H8BrClO2Purity:Min. 95%Molecular weight:263.52 g/mol4,6-Dichloro-2-methylnicotinic acid
CAS:Please enquire for more information about 4,6-Dichloro-2-methylnicotinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%3-Chloro-4-(3-fluorobenzyloxy)aniline
CAS:3-Chloro-4-(3-fluorobenzyloxy)aniline is a potent inhibitor of the epidermal growth factor receptor (EGFR), which is a tyrosine kinase that plays an important role in the initiation and progression of cancer. The compound has been shown to inhibit the proliferation of human cancer cell lines, such as breast cancer and prostate cancer, by blocking EGFR signaling. 3-Chloro-4-(3-fluorobenzyloxy)aniline also inhibits the activity of other kinases, such as lapatinib and 2-amino-4-fluorobenzoic acid. This inhibition may be due to its ability to bind to the ATP binding site on these enzymes.Formula:C13H11ClFNOPurity:Min. 95%Color and Shape:PowderMolecular weight:251.68 g/molMethyl 3,5-dichloro-4-methoxybenzoate
CAS:Methyl 3,5-dichloro-4-methoxybenzoate is a fine chemical and useful building block for research chemicals. It belongs to the class of speciality chemicals and can be used as a reagent in organic synthesis. Methyl 3,5-dichloro-4-methoxybenzoate is a versatile building block that has been reported in the synthesis of many complex compounds. This compound can also be used as an intermediate or scaffold for medicinal chemistry applications.Formula:C9H8Cl2O3Purity:Min. 95%Molecular weight:235.06 g/molArg-Glu(EDANS)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt
CAS:Please enquire for more information about Arg-Glu(EDANS)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C91H129N25O25SPurity:Min. 95%Molecular weight:2,005.22 g/molAbz-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt
CAS:Please enquire for more information about Abz-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C42H58N12O16Purity:Min. 95%Molecular weight:986.98 g/molN-[4-(2-Bromoacetyl)phenyl]methanesulfonamide
CAS:N-[4-(2-Bromoacetyl)phenyl]methanesulfonamide is a chiral biocatalytic agent, which is synthesized by chemoenzymatic or enzymatic reactions. It has been used in enantioselective synthesis of 4-aminoacetophenone and as an antiarrhythmic agent. This compound is not active against bacterial infections.Formula:C9H10BrNO3SPurity:Min. 95%Molecular weight:292.15 g/molCGRP (chicken) trifluoroacetate salt
CAS:Trifluoroacetate saltFormula:C165H262N52O50S2Purity:Min. 95%Molecular weight:3,838.3 g/mol3-Bromopyridin-4-ol
CAS:3-Bromopyridin-4-ol is a pyrrole that can be used as a cancer therapy. It inhibits the growth of cancer cells by binding to the mkn-45 on the surface of the cell, which prevents it from binding to other proteins and initiating cell proliferation. 3-Bromopyridin-4-ol also inhibits 2-amino-4-hydroxypyridine aminations, which are reactions that produce compounds that promote cancer. This compound class has inhibitory activity against the growth of cancer cells in vitro and in vivo. 3-Bromopyridin-4-ol is an oxindole and amide with a hydroxy group on its side chain. It can be synthesized from 3-bromo-5 hydroxypyridine by reacting it with ammonia or methylamine. The synthesis of this compound can be achieved by reacting 2 chloroacetaldehyde with nitroethane in presenceFormula:C5H4BrNOPurity:Min. 95%Color and Shape:PowderMolecular weight:174 g/mol(2-Chlorophenyl)boronic acid
CAS:2-Chlorophenylboronic acid is a diphenyl ether that can be used as a building block for the synthesis of benzodiazepine receptor ligands. It has been shown to be an efficient nucleophile, leading to the formation of carbonyl groups in the presence of halides. 2-Chlorophenylboronic acid has also been shown to inhibit p38 kinase activity and may be useful for anticancer therapy.Formula:C6H6BClO2Purity:Min. 95%Molecular weight:156.37 g/molH-Trp(Boc)-2-chlorotrityl resin (100-200 mesh)
Please enquire for more information about H-Trp(Boc)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%(Leu13)-Motilin (human, porcine) trifluoroacetate salt
CAS:Motilin is a gastrointestinal hormone that stimulates gastric motility and the release of pancreatic enzymes. It is also used to treat postoperative ileus, abdominal pain, and gastroduodenal ulcers. Motilin is administered nasogastrically to stimulate the movement of food through the stomach and intestines. The trifluoroacetate salt form is used in this application because it has a longer duration of action than other salts.Formula:C121H190N34O35Purity:Min. 95%Molecular weight:2,681.01 g/molNeuropeptide VF (124-131) (human) trifluoroacetate salt
CAS:Neuropeptide VF (124-131) (human) trifluoroacetate salt H-Val-Pro-Asn-Leu-Pro-Gln-Arg-Phe-NH2 trifluoroacetate salt is a peptide that is synthesized in the hypothalamus and is involved in the regulation of gonadotropin secretion. It has been shown to inhibit cell growth in vitro and to have an inhibitory effect on cancer cells. This peptide also binds to receptors α, adenohypophyseal, cellular, testicular, vasoactive intestinal peptide, messenger RNA, estradiol benzoate, cancer, and progesterone receptor.Formula:C45H72N14O10Purity:Min. 95%Molecular weight:969.14 g/molAstressin trifluoroacetate salt
CAS:Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.Formula:C161H269N49O42Purity:Min. 95%Molecular weight:3,563.16 g/molHTLV-1 Tax (11-19) trifluoroacetate salt
CAS:Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C56H79N9O12Purity:Min. 95%Molecular weight:1,070.28 g/molZ-Tyr-Val-Ala-DL-Asp-fluoromethylketone
CAS:Please enquire for more information about Z-Tyr-Val-Ala-DL-Asp-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C30H37FN4O9Purity:Min. 95%Molecular weight:616.63 g/molAmyloid beta-Protein (1-42) hydrochloride salt
CAS:Key subunit of extracellular plaques found in the brains of patients with Alzheimer's disease; Hydrochloride saltFormula:C203H311N55O60SPurity:Min. 95%Molecular weight:4,514.04 g/molc4-Ethyl-2,3-dioxo-piperazine carbonyl chloride
CAS:c4-Ethyl-2,3-dioxo-piperazine carbonyl chloride is a chloroformate that is used in the synthesis of carbamates. It is used in the production of triphosgene, which is an intermediate for the production of herbicides and pesticides. The impurities found in this substance are n-hexane, flow rate, chloride, chloroformate and solvents. This product can be synthesized by reacting c4-ethyl-2,3-dioxopiperazine with carbon tetrachloride. The reaction time required to produce this product is 2 hours at a temperature between 100°C and 150°C. The optimum pH range for the reaction is 8 - 10.Formula:C7H9ClN2O3Purity:Min. 95%Color and Shape:PowderMolecular weight:204.61 g/mol5-Fluoro-2-hydrazinopyridine
CAS:Please enquire for more information about 5-Fluoro-2-hydrazinopyridine including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C5H6FN3Purity:Min. 95%Molecular weight:127.12 g/mol(Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) trifluoroacetate salt
CAS:Please enquire for more information about (Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C196H308N58O53Purity:Min. 95%Molecular weight:4,324.9 g/molAmyloid Bri Protein (1-23) trifluoroacetate salt
CAS:Please enquire for more information about Amyloid Bri Protein (1-23) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C116H175N31O35S2Purity:Min. 95%Molecular weight:2,627.95 g/molH-Leu-Ser-Lys-Leu-OH trifluoroacetate salt
CAS:Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C21H41N5O6Purity:Min. 95%Molecular weight:459.58 g/molH-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt
Please enquire for more information about H-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C42H62N14O16SPurity:Min. 95%Molecular weight:1,051.09 g/mol(Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C194H295N53O59SPurity:Min. 95%Molecular weight:4,345.81 g/molRVG-9R trifluoroacetate salt
CAS:Please enquire for more information about RVG-9R trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C201H334N82O55S2Purity:Min. 95%Molecular weight:4,843.45 g/molH-Leu-Ser-Lys-Leu-NH2 trifluoroacetate salt
CAS:L-Leu-Ser-Lys-Leu-NH2 is a cyclic peptide with the amino acid sequence H-Leu-Ser-Lys-Leu. It has been shown to have receptor activity and can be used as an experimental model of growth factors. L-Leu-Ser-Lys-Leu was found to stimulate collagen synthesis in a collagen gel, which may be due to its ability to inhibit the release of growth factor β1. L-Leu-Ser Lys Leu also has anti cancer effects by inhibiting the proliferation of malignant brain cells, as well as tubulointerstitial injury and renal cell carcinoma. This compound may also have some use in treating subarachnoid hemorrhage and fetal bovine serum (FBS) for tissue culture.Formula:C21H42N6O5Purity:Min. 95%Molecular weight:458.6 g/molMethyl 3-amino-4-bromo-2-nitrobenzoate
CAS:Please enquire for more information about Methyl 3-amino-4-bromo-2-nitrobenzoate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C8H7BrN2O4Purity:Min. 95%Molecular weight:275.06 g/molRhodium(III) chloride hydrate
CAS:Rhodium(III) chloride hydrate is a catalyst that is used in the oxidation of aromatic hydrocarbons. It has been shown to have an acidic reaction with hydrochloric acid and is used in the oxidation of benzene, toluene, ethylbenzene, and xylene. Rhodium(III) chloride hydrate has also been shown to be a good catalyst for the production of polycyclic aromatic hydrocarbons from light emitting diodes. This product can be used as an oxidizing agent in organic synthesis reactions. The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that belongs to the class of rifamycins. It is the most active of the rifamycins for the treatment of tuberculosis. Rifapentine inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. The high frequency of
Formula:RhCl3·xH2OPurity:Min. 95%Molecular weight:209.26 g/molGalanin (human) trifluoroacetate salt
CAS:Please enquire for more information about Galanin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C139H210N42O43Purity:Min. 95%Molecular weight:3,157.41 g/molHIV (gp120) Fragment (421-438) trifluoroacetate salt
CAS:Please enquire for more information about HIV (gp120) Fragment (421-438) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C99H148N24O25S2Purity:Min. 95%Molecular weight:2,138.51 g/molNeuropeptide Y (13-36) (porcine) trifluoroacetate salt
CAS:Please enquire for more information about Neuropeptide Y (13-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C135H209N41O36Purity:Min. 95%Molecular weight:2,982.36 g/molOsteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt
CAS:Please enquire for more information about Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C27H42N10O7Purity:Min. 95%Molecular weight:618.69 g/molBz-Val-Gly-Arg-AMC trifluoroacetate salt
CAS:Bz-Val-Gly-Arg-AMC is a growth factor that activates the extracellular signal-regulated protein kinase (ERK) pathway. The activation of this pathway results in an increase in cellular proliferation and inhibition of tumor growth. Bz-Val-Gly-Arg-AMC has been shown to activate ERK by interacting with VSMCs, which are cells that act as a structural component of blood vessels and play a role in regulating blood flow. This compound also induces phosphorylation of glycogen synthase kinase 3β and inhibits its activity, leading to increased protein synthesis through glycolysis. Bz-Val-Gly-Arg-AMC can be used as an inhibitor to bortezomib, a proteolytic enzyme that is used to treat cancer.Formula:C30H37N7O6Purity:Min. 95%Molecular weight:591.66 g/molBiotinyl-(Leu8,D-Trp22,Tyr25)-Somatostatin-28 trifluoroacetate salt
CAS:Please enquire for more information about Biotinyl-(Leu8,D-Trp22,Tyr25)-Somatostatin-28 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C148H223N43O42S3Purity:Min. 95%Molecular weight:3,372.82 g/molNesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt
Please enquire for more information about Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C167H260N40O54Purity:Min. 95%Molecular weight:3,692.09 g/mol1,3,5-Trichlorobenzene
CAS:Controlled Product1,3,5-Trichlorobenzene is a chlorinated aromatic compound that is used as an intermediate in the production of rubber and plastics. 1,3,5-Trichlorobenzene has a hydrophobic effect due to the presence of three carbon chains. This property allows 1,3,5-trichlorobenzene to dissolve in oils and fats. It has a high solubility in pentane and hexane. The molecular weight of 1,3,5-trichlorobenzene is 116.1 g/mol. 1,3,5-Trichlorobenzene can also be used as a solvent for diazonium salts which react with hydrogen chloride to produce azo dyes. The structural analysis of this compound was performed by NMR spectroscopy on the hydrogen bond between the chlorine atom and methyl group adjacent to it. The NMR spectrum data was then modeled using molecular modeling software. 1Formula:C6H3Cl3Purity:Min. 95%Molecular weight:181.45 g/molAngiotensin I/II (1-7) trifluoroacetate salt
CAS:Angiotensin I/II (1-7) trifluoroacetate salt is a selective inhibitor of angiotensin II. It blocks the activity of angiotensin II, and thereby prevents the activation of growth factor-β1, which leads to a decrease in pulmonary hypertension. The drug has also been shown to be effective in blocking dextran sulfate absorption, as well as preventing bowel disease by inhibiting receptor activity. Angiotensin I/II (1-7) trifluoroacetate salt has been shown to have an anti-inflammatory effect on the cardiovascular system by blocking cell signaling pathways and reducing blood pressure. This drug is used for treatment of metabolic disorders such as atherosclerotic lesion, cardiac diseases such as coronary heart diseases, and bowel disease.Formula:C41H62N12O11Purity:Min. 95%Molecular weight:899.01 g/mol2-Cyano-3,4,5,6-tetrachloropyridine
CAS:2-Cyano-3,4,5,6-tetrachloropyridine is a genotoxic compound that is used for the preparation of picolinic acid. It has been shown to induce DNA damage and cytotoxicity in vitro. The reaction products of this compound have also been found to be genotoxic in vitro and in vivo. This chemical has been shown to inhibit the growth of cells in culture as well as cause cell death by releasing hydrogen chloride gas. 2-Cyano-3,4,5,6-tetrachloropyridine is a potent mutagen and carcinogen that can be activated by fluorine or chlorine compounds. This chemical can also form chlorinated derivatives with chlorine. 2-Cyano-3,4,5,6-tetrachloropyridine reacts with phosphorus pentachloride to produce hydrogen chloride gas and other reaction products such as chloride (Cl) or sublimed (PFormula:C6Cl4N2Purity:Min. 95%Molecular weight:241.89 g/mol1-(5-Bromopyrimidin-2-yl)ethanone
CAS:Please enquire for more information about 1-(5-Bromopyrimidin-2-yl)ethanone including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C6H5BrN2OPurity:Min. 95%Molecular weight:201.02 g/mol5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS:Please enquire for more information about 5-FAM-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C85H128N32O20Purity:Min. 95%Molecular weight:1,918.13 g/molVIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt
CAS:Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C50H77N9O12SPurity:Min. 95%Molecular weight:1,028.27 g/molBoc-D-Homoarg (Et)2-OH (symmetrical) hydrochloride salt
CAS:Please enquire for more information about Boc-D-Homoarg (Et)2-OH (symmetrical) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C16H32N4O4Purity:Min. 95%Molecular weight:344.45 g/mol4'-Bromo-2'-fluoroacetophenone
CAS:4'-Bromo-2'-fluoroacetophenone is a bifunctional reagent that reacts with nucleophiles to form conjugates. It is used in the preparation of fluorinated DNA and RNA, as well as in electron-transfer reactions. The selectivity of 4'-bromo-2'-fluoroacetophenone can be attributed to the presence of fluorine atoms on both ends of the molecule.
Formula:C8H6BrFOPurity:Min. 95%Molecular weight:217.04 g/molNeuropeptide Y (porcine) trifluoroacetate salt
CAS:Neuropeptide Y (porcine) trifluoroacetate salt H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifluoroacetate salt is a peroxidase enzyme that is biotinylated and purified from porcine sources. It has been used as an antiserum in the development of a plate sealer.
Formula:C190H287N55O57Purity:Min. 95%Molecular weight:4,253.65 g/mol(1,2-Dibromoethyl)benzene
CAS:(1,2-Dibromoethyl)benzene is an organic compound that belongs to the group of cationic surfactants. It can be used as a particle in analytical methods and has been shown to react with hydroxyl groups on the surface of silica gel. (1,2-Dibromoethyl)benzene has also been used in a reaction with chlorides, nitrates, and inorganic acids to form hydrochloric acid. The reaction products are hydroxyl group, chloride, nitrogen atoms, inorganic acid, hydroxy group, hydrogen chloride, diameter, water vapor.
Formula:C8H8Br2Purity:Min. 95%Color and Shape:PowderMolecular weight:263.96 g/molPrepro VIP (81-122) (human) trifluoroacetate salt
CAS:Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C202H325N53O64SPurity:Min. 95%Molecular weight:4,552.13 g/molKR-12 (human) trifluoroacetate salt
CAS:Please enquire for more information about KR-12 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C71H127N25O15Purity:Min. 95%Molecular weight:1,570.93 g/molFibronectin Fragment (1376-1380) trifluoroacetate salt
CAS:Please enquire for more information about Fibronectin Fragment (1376-1380) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C24H39N11O8Purity:Min. 95%Molecular weight:609.64 g/molRenin Substrate 1 trifluoroacetate salt
CAS:Please enquire for more information about Renin Substrate 1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C109H157N31O22S2Purity:Min. 95%Molecular weight:2,317.74 g/mol(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys The product is a compound that has been shown to inhibit the formation of beta amyloid peptides in the brain. It binds to the beta amyloid peptide and prevents its aggregation, thereby preventing the formation of plaques and inhibiting neuronal cell death. The product contains no detectable levels of trehalose, which makes it ideal for use in brain imaging studies. This product may also be used as a predictive biomarker for Alzheimer's disease because it can be detected in cerebrospinal fluid and plasma.Formula:C194H296N54O57SPurity:Min. 95%Molecular weight:4,328.82 g/mol(Ala11,D-Leu15)-Orexin B (human) trifluoroacetate salt
CAS:Please enquire for more information about (Ala11,D-Leu15)-Orexin B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C120H206N44O35SPurity:Min. 95%Molecular weight:2,857.26 g/mol(5-Bromo-2-hydroxyphenyl)acetone
CAS:5-Bromo-2-hydroxyphenyl)acetone is a chemical that is used as a building block in the synthesis of other compounds. It can be used as a reagent to produce 5-bromo-2,4-dihydroxyphenylacetic acid, which has been shown to have antiinflammatory and analgesic effects. 5-Bromo-2-hydroxyphenyl)acetone is also useful for the synthesis of polymers with applications in electronics and as an intermediate for the production of pharmaceuticals.Formula:C9H9BrO2Purity:Min. 95%Color and Shape:PowderMolecular weight:229.07 g/mol2-[(1S)-1-Aminopropyl]-5-fluoro-3-phenyl-4(3H)-quinazolinone
CAS:Controlled ProductIntermediate in the synthesis of idelalisib (CAL 101)
Formula:C17H16FN3OPurity:Min. 95%Molecular weight:297.33 g/mol(Des-Gly10,D-Trp3,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
Please enquire for more information about (Des-Gly10,D-Trp3,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C59H84N16O12Purity:Min. 95%Molecular weight:1,209.4 g/mol(Cys(Et)2·7)-a-CGRP (human) trifluoroacetate salt
CAS:Please enquire for more information about (Cys(Et)2·7)-a-CGRP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C167H277N51O49S2Purity:Min. 95%Molecular weight:3,847.43 g/molNeuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt
Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C175H290N56O59Purity:Min. 95%Molecular weight:4,122.52 g/molBAM-22P (8-22) trifluoroacetate salt
CAS:BAM-22P (8-22) trifluoroacetate salt is a compound that has been shown to be an effective drug for the treatment of pain. It has been shown to have an effect on bone cancer, which can be activated by serotonin. This compound may be beneficial in treating nerve injury and fibrosarcoma cells. BAM-22P (8-22) trifluoroacetate salt is an allosteric modulator of the serotonin receptor and may be used as a treatment for pain in wild-type mice. The molecule is also a serotonin reuptake inhibitor, which prevents the reuptake of serotonin into the presynaptic neuron. This leads to increased levels of serotonin in the synapse and increased pain relief.Formula:C91H127N25O23SPurity:Min. 95%Molecular weight:1,971.2 g/molNeuropeptide Y (free acid) (human, rat) trifluoroacetate salt
CAS:Please enquire for more information about Neuropeptide Y (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C189H284N54O58SPurity:Min. 95%Molecular weight:4,272.67 g/molH-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-A rg-D-Arg-OH trifluoroacetate salt
CAS:Please enquire for more information about H-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-A rg-D-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C102H183N45O26Purity:Min. 95%Molecular weight:2,455.83 g/molFuraltadone hydrochloride
CAS:Furaltadone hydrochloride is a drug that belongs to the class of quinolones. It is used as an antibiotic for the treatment of microbial infections and may be used in combination with other antibiotics. Furaltadone hydrochloride binds to bacterial DNA, inhibiting protein synthesis, leading to cell death. The mechanism of action has not been fully elucidated, but it is thought that furaltadone hydrochloride binds to the sodium ion in the hydroxyl group of DNA. This binding prevents the formation of an antibiotic-inhibitor complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division. Furaltadone hydrochloride has been shown to have a low systemic effect and high adsorption rate in animals; therefore it may be used as an oral antibiotic or as an injectable drug.Formula:C13H17ClN4O6Purity:Min. 95%Color and Shape:Yellow SolidMolecular weight:360.75 g/mol3-Bromo-5-(trifluoromethyl)aniline
CAS:3-Bromo-5-(trifluoromethyl)aniline is a synthetically useful compound that can be used for the synthesis of other organic compounds. It has been shown to react with nilotinib, an anticancer drug, to produce a reaction yield of 83%. This reaction was carried out in an impure environment and produced some impurities. The reaction was conducted using acetonitrile as the solvent and the desired product was obtained by using a high-performance liquid chromatography (HPLC) method. The resulting product was deuterated with deuterium gas. 3-Bromo-5-(trifluoromethyl)aniline is insoluble in water and soluble in organic solvents such as benzene, chloroform, dichloromethane, acetonitrile, and ether. The chemical formula for this substance is C8H4BrF3NO2.Formula:C7H5BrF3NPurity:Min. 95%Molecular weight:240.02 g/mol
![3-Iodo-1H-pyrrolo[2,3-b]pyridine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFI42979.webp&w=3840&q=75)
![Imidazo[1,2-a]pyridin-7-amine hydrobromide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFI111192.webp&w=3840&q=75)
![4,6-Dichloro-1H-pyrazolo[4,3-c]pyridine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFD35292.webp&w=3840&q=75)
![N-[2-[(2-Bromo-4,6-dinitrophenyl)azo]-5-(diethylamino)phenyl]acetamide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFB151321.webp&w=3840&q=75)
![2,7-Bis[2-(diethylamino)ethoxy]-9-fluorenone dihydrochloride](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFB37106.webp&w=3840&q=75)
![2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFB66447.webp&w=3840&q=75)
![(alphaR)-alpha-[[[2-(4-Nitrophenyl)ethyl]amino]methyl]benzenemethanol hydrochloride](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFN156825.webp&w=3840&q=75)
![5,6,7,7a-Tetrahydrothieno[3,2-c]pyridinone hydrochloride](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFT28146.webp&w=3840&q=75)
![N-[4-(2-Bromoacetyl)phenyl]methanesulfonamide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFB19192.webp&w=3840&q=75)
![2-[(1S)-1-Aminopropyl]-5-fluoro-3-phenyl-4(3H)-quinazolinone](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFA96431.webp&w=3840&q=75)
![H-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Val-Glu-Phe-Gly-Gly-D-Arg-D-Arg…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFG111107.webp&w=3840&q=75)
