
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,469 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38260 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Biotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H92N20O15SPurity:Min. 95%Molecular weight:1,425.62 g/mol2,4-Dichloro-5-methoxyaniline
CAS:<p>2,4-Dichloro-5-methoxyaniline (2,4-DMA) is a trifluoroacetic acid derivative that inhibits the growth of cancer cells by interfering with cellular processes such as DNA replication and protein synthesis. It has been shown to have anticancer activity in vitro and in vivo. In addition, 2,4-DMA can inhibit the growth of cancer cells by preventing epidermal growth factor from binding to its receptor on the cell surface. A recent study showed that 2,4-DMA has anti-angiogenic properties and can prevent tumor growth by inhibiting bcr-abl kinase activity. 2,4-DMA also has an acidic property which may be due to its conversion of trifluoroacetic acid into hydrogen fluoride (HF) and hydrogen chloride (HCl).<br>2,4-Dichloro-5-methoxyaniline was approved for use in Japan</p>Formula:C7H7Cl2NOPurity:Min. 95%Color and Shape:White To Pink SolidMolecular weight:192.04 g/mol(2S,4R)-Fmoc-Mpt(Trt)-OH
CAS:<p>Please enquire for more information about (2S,4R)-Fmoc-Mpt(Trt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H33NO4SPurity:Min. 95%Color and Shape:PowderMolecular weight:611.75 g/molN-Heptyl-Hyp-OH
CAS:<p>The synthesis of N-heptyl-hyp-OH is a chiral resolution process for the preparation of the enantiomers of heptanol. The enantioselective synthesis of this compound is achieved by converting the racemic mixture to an optically active form by means of a chiral auxiliary, followed by protection and hydrolysis. This method produces an optically pure product in high yield.</p>Formula:C12H23NO3Purity:Min. 95%Molecular weight:229.32 g/molH-Ala-Pro-Gly-OH
CAS:<p>Glycine is a small, sweet-tasting amino acid that is used in the biosynthesis of proteins. It has three linkages: an amide linkage to proline, and an ester linkage to alanine. The l-glycine molecule exists as two possible tautomers, the enol and keto forms. The enol form predominates at physiological pH; however, at very low pH, the keto form predominates. Glycine also has a cyclic structure and can be classified as a tripeptide.</p>Formula:C10H17N3O4Purity:Min. 95%Molecular weight:243.26 g/molAlarin (human) trifluoroacetate salt
CAS:<p>Alarin is a human protein that was originally developed as an antiserum to seal wounds. It is used in the manufacture of pharmaceuticals, such as vaccines and serums. Alarin has also been used in immunoassays for the detection of antibodies in blood, serum, and other body fluids. Alarin is a protein that can be biotinylated and used as a substrate for peroxidase-conjugated streptavidin. This allows it to be utilized in enzyme-linked immunosorbent assay (ELISA) tests.</p>Formula:C127H205N43O35Purity:Min. 95%Molecular weight:2,894.26 g/molH-β-Ala-Phe-OH
CAS:<p>H-beta-Ala-Phe-OH is a synthetic dipeptide that is positioned at the C terminus of the l-phenylalanine residue. It has two residues, H and beta-Ala, which are connected by a peptide bond between the carboxyl group of beta-Ala and the amino group of phenylalanine. The crystallographic structure of this molecule shows that it adopts a helical conformation with hydrogen bonds between adjacent helices. This water-soluble molecule has been shown to have antihypertensive properties in animal studies.</p>Formula:C12H16N2O3Purity:Min. 95%Color and Shape:PowderMolecular weight:236.27 g/molSuc-Ala-Phe-Lys-AMC acetate
CAS:<p>Suc-Ala-Phe-Lys-AMC acetate salt is a fatty acid that is metabolized by the enzyme plasminogen activator inhibitor 1 (PAI-1) to form AMC. It is used as a marker for PAI-1 activity in plasma, as well as in other extracellular fluids. Suc-Ala-Phe-Lys-AMC acetate salt has been shown to be effective in treating diseases caused by low blood sugar levels, such as diabetes mellitus type 2. Studies have also shown that it can be used to monitor the progress of metabolic disorders such as obesity and type 2 diabetes mellitus.</p>Formula:C32H39N5O8•C2H4O2Purity:Min. 95%Color and Shape:PowderMolecular weight:681.73 g/molGinseng Tetrapeptide
CAS:<p>Please enquire for more information about Ginseng Tetrapeptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H33N7O7Purity:Min. 95%Molecular weight:459.5 g/molCyclo(leu-leu)
CAS:<p>Cyclo(leu-leu) is a glycosidase inhibitor that has been shown to have an inhibitory effect on the biosynthesis of aminoacylated proteins. Cyclo (leu-leu) is derived from the wild-type strain of a fungus, which is a genus of endophytic fungi. This compound inhibits the synthesis of proteins by binding to glycosylated amino acid residues and preventing their hydrolysis. Cyclo (leu-leu) also has homologous regions with mellein, which is another type of glycosidase inhibitor that binds to the enzyme protein kinase C, inhibiting protein synthesis and leading to cell death.</p>Formula:C12H22N2O2Purity:Min. 95%Molecular weight:226.32 g/molAutocamtide-2-Related Inhibitory Peptide
CAS:<p>Please enquire for more information about Autocamtide-2-Related Inhibitory Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H116N22O19Purity:Min. 95%Molecular weight:1,497.74 g/molH-Gly-Arg-Gly-Glu-Ser-Pro-OH
CAS:<p>H-Gly-Arg-Gly-Glu-Ser-Pro-OH is a peptide fragment of collagen that has been used in research to study the effects of this protein on fibrosis, bowel disease, and autoimmune diseases. It has also been found to be able to activate stem cells and is being studied for its application as a cell factor. This peptide fragment inhibits the growth of Candida glabrata by stimulating the production of growth factors such as β1 and colony stimulating factor. It also stimulates the production of integrin receptors, which are important for cell adhesion. H-Gly-Arg-Gly-Glu-Ser-Pro-OH has also been shown to have an antiviral effect in vivo models.</p>Formula:C23H39N9O10Purity:Min. 95%Molecular weight:601.61 g/molACTH (1-39) (guinea pig)
CAS:<p>Please enquire for more information about ACTH (1-39) (guinea pig) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C206H308N56O58SPurity:Min. 95%Molecular weight:4,529.06 g/mol(Deamino-Cys1,Val4,D-Arg8)-Vasopressin
CAS:<p>Vasopressin 3-mercaptopropionyl-Tyr-Phe-Val-Asn-Cys-Pro-D-Arg-Gly-NH2 is a peptide hormone that is involved in the regulation of water balance and blood pressure. It is a vasoconstrictor and has been shown to have an inhibitory effect on cellular targets such as soluble guanylate cyclase, which are involved in the synthesis of cGMP. Vasopressin 3-mercaptopropionyl-Tyr-Phe-Val-Asn-Cys Pro D Arg Gly NH2 also binds to the oxytocin receptor, which may be responsible for its vasodilatory effect.</p>Formula:C46H65N13O11S2Purity:Min. 95%Molecular weight:1,040.22 g/molH-Lys(2-chloro-Z)-OBzl·HCl
CAS:<p>Please enquire for more information about H-Lys(2-chloro-Z)-OBzl·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H25ClN2O4·HClPurity:Min. 95%Molecular weight:441.35 g/mol(D-Lys(nicotinoyl)1,b-(3-pyridyl)-Ala3,3,4-dichloro-D-Phe5,Asn6,D-Trp7·9, Nle 11)-Substance P trifluoroacetate salt
CAS:<p>Substance P is a tachykinin neuropeptide that belongs to the tachykinin family. It is found in the central and peripheral nervous system and has been shown to have an important role in locomotor activity, protein synthesis, receptor activity, and neurotransmitter release. Substance P is also associated with a number of diseases such as infectious diseases, sciatic nerve pain, and vasoactive intestinal peptide (VIP) production. This substance has been used for the diagnosis of neurogenic bladder dysfunction by measuring its effects on urinary bladder contractility.</p>Formula:C86H104Cl2N18O13Purity:Min. 95%Molecular weight:1,668.76 g/molBoc-(Dmmb(Trt))Gly-OH
CAS:<p>Please enquire for more information about Boc-(Dmmb(Trt))Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H37NO6SPurity:Min. 95%Molecular weight:599.74 g/molLQEQ-19 (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about LQEQ-19 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C106H165N29O34Purity:Min. 95%Molecular weight:2,389.62 g/mol(Met(O2)35)-Amyloid b-Protein (1-42)
CAS:<p>Please enquire for more information about (Met(O2)35)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C203H311N55O62SPurity:Min. 95%Molecular weight:4,546.04 g/molH-Phe-AMC trifluoroacetate salt
CAS:<p>H-Phe-AMC Trifluoroacetate salt is a synthetic, protease inhibitor that inhibits the activity of serine and cysteine proteases. It binds to the active site of these enzymes and blocks their function. H-Phe-AMC trifluoroacetate salt has been used in food chemistry to hydrolyze proteins, and can be used to measure enzyme activities. This product also has been shown to have biological functions such as the inhibition of molting, physiological function, and the prevention of carcinogenesis.</p>Formula:C19H18N2O3Purity:Min. 95%Molecular weight:322.36 g/molH-Met-Glu-OH
CAS:<p>H-Met-Glu-OH is a synthetic substance that inhibits the activity of cytochrome P450. It binds to cells, specifically platelets, and causes degranulation and activation of calcium ion channels. This leads to an increase in intracellular calcium ions that triggers blood clotting. H-Met-Glu-OH has been shown to be effective in treating cardiovascular diseases such as high blood pressure and heart arrhythmia. Clopidogrel is often used with H-Met-Glu-OH to prevent platelet aggregation, which would otherwise block the effectiveness of H-Met-Glu-OH.<br>H-Met-Glu has a high affinity for collagen and binds more efficiently to platelets than other cell types. This binding is reversible, which allows for repeated doses without causing toxicity or adverse effects on healthy cells.</p>Formula:C10H18N2O5SPurity:Min. 95%Molecular weight:278.33 g/molHuman CMV Assemblin Protease Inhibitor
CAS:<p>Please enquire for more information about Human CMV Assemblin Protease Inhibitor including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C46H86N18O14Purity:Min. 95%Molecular weight:1,115.29 g/molBoc-Cholecystokinin Octapeptide (desulfated)
CAS:<p>Please enquire for more information about Boc-Cholecystokinin Octapeptide (desulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H70N10O15S2Purity:Min. 95%Molecular weight:1,163.32 g/molFmoc-N-methyl-L-valine
CAS:<p>Fmoc-N-methyl-L-valine is a synthetic immunosuppressant that acts by inhibiting the production of cytokines and other inflammatory mediators. It binds to the enzyme cyclooxygenase, which is involved in the synthesis of prostaglandins and thromboxanes. Fmoc-N-methyl-L-valine has been shown to be effective against gram-positive bacteria. This compound also inhibits xanthine oxidase and may act as an analog for azathioprine, which is used in the treatment of autoimmune diseases such as rheumatoid arthritis. The reaction mechanism for this compound is not well understood but appears to involve a nucleophilic attack on a benzoquinoneiminium cation formed from the attack on an electron deficient benzene ring with a triphosgene electrophile.</p>Formula:C21H23NO4Purity:Min. 95%Molecular weight:353.41 g/molH-Cys(Bzl)-Gly-OH trifluoroacetic acid
CAS:<p>Please enquire for more information about H-Cys(Bzl)-Gly-OH trifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16N2O3S•(CF3CO2H)xPurity:Min. 95%Molecular weight:268.33 g/molAc-Lys-D-Ala-D-lactic acid·acetate
CAS:Controlled Product<p>Please enquire for more information about Ac-Lys-D-Ala-D-lactic acid·acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H25N3O6·C2H4O2Purity:Min. 95%Molecular weight:391.42 g/molIsoprenaline sulphate dihydrate
CAS:<p>4-[1-Hydroxy-2-[(1-methylethyl)amino]ethyl]-1,2-benzenediol sulfate dihydrate (benserazide) is a cholinergic agent that has been shown to increase the release of acetylcholine by acting as an agonist at nicotinic receptors. It increases the amount of acetylcholine released in the brain and can be used for the treatment of Alzheimer's disease. Benserazide has also been shown to have a depressant effect on the respiratory system, which can be beneficial for lung diseases. This drug also has anti-inflammatory properties and can inhibit growth factor synthesis.</p>Formula:C22H34N2O6·H2SO4·2H2OPurity:Min. 95%Color and Shape:PowderMolecular weight:520.59 g/molH-Glu-Glu-Asp-OH
CAS:<p>H-Glu-Glu-Asp-OH is a tripeptide that is a marker for endothelial cell proliferation. This peptide sequence has been shown to promote endothelial cell function, as well as to have atherogenic properties. The hydrolysate of H-Glu-Glu-Asp-OH has been shown to inhibit the growth of endothelial cells and functions in vitro.END><br>END></p>Formula:C14H21N3O10Purity:Min. 95%Molecular weight:391.33 g/molN-Acetyl-DL-leucine
CAS:<p>N-Acetyl-DL-leucine is a non-protein amino acid that has been shown to have a variety of pharmacological effects. It has been found to reduce neuronal death and protect against cerebellar damage. N-Acetyl-DL-leucine acts by binding to the alpha subunit of the glutamate receptor, which increases its affinity for glutamate. This leads to an increased response in neuronal cells, and the prevention of neurotoxicity. N-acetyl-l-leucine has also been shown to be effective as a treatment for vestibular disorders. However, it is only soluble at high concentrations in water, so it cannot be taken orally without first being dissolved in alcohol or another solvent.</p>Formula:C8H15NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:173.21 g/molZ-N-Me-Thr(tBu)-OH·CHA
CAS:<p>Please enquire for more information about Z-N-Me-Thr(tBu)-OH·CHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H25NO5·C6H13NPurity:Min. 95%Molecular weight:422.56 g/molFmoc-Gln(Trt)-Thr(Psi(Me ,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Gln(Trt)-Thr(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C46H45N3O7Purity:Min. 95%Molecular weight:751.87 g/molH-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser-OH
CAS:<p>H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser-OH is a synthetic peptide that has been shown to inhibit the production of angiotensin and angiotensinogen by interfering with the binding of its receptor. It has also been shown to inhibit the production of proinflammatory cytokines, such as tumor necrosis factor alpha (TNFα), interleukin 1beta (IL1β), and IL6, in human macrophages. HAVY can also inhibit toll like receptor 4 mediated inflammatory responses in vivo. HAVY is an inhibitor of angiotensin II type 1 receptor activity, which may be useful in treating cardiovascular diseases such as atherosclerotic lesions, hypertension, and bowel disease.</p>Formula:C85H123N21O20Purity:Min. 95%Molecular weight:1,759.02 g/molH-Lys-Ser-OH·HCl
CAS:<p>Please enquire for more information about H-Lys-Ser-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H19N3O4·HClPurity:Min. 95%Molecular weight:269.73 g/molAloc-OSu
CAS:<p>Aloc-OSu is a glycosylated glycopeptide antibiotic that belongs to the class of degradable antibiotics. The drug binds to the enzyme UDP-N-acetylglucosamine:glycoprotein glucosyltransferase, thereby inhibiting bacterial cell wall synthesis. Aloc-OSu has been shown to be effective against methicillin resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, although is not active against acid-fast bacteria such as Mycobacterium tuberculosis or Mycobacterium avium complex. Aloc-OSu has shown anti-inflammatory properties, which may be due to its inhibition of prostaglandin synthesis.</p>Formula:C8H9NO5Purity:Min. 95%Molecular weight:199.16 g/molFmoc-Phe-Pro-OH
CAS:<p>Fmoc-Phe-Pro-OH is a sensor molecule that has been used in supramolecular, nanostructured, and biological applications. It is a supramolecular self-assembly process that can be applied to sensors, devices, and modules. Fmoc-Phe-Pro-OH can be used as a biological source for sensing bacteria or other molecules of interest. The structural properties of Fmoc-Phe-Pro-OH have been studied extensively and it has been found to have favorable properties for use in humans. Advances in this field are ongoing with the hope of improving the understanding of biological systems and human health.</p>Formula:C29H28N2O5Purity:Min. 95%Molecular weight:484.54 g/molFmoc-Gly-Cys(Psi(Dmp,H)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Gly-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H28N2O7SPurity:Min. 95%Molecular weight:548.61 g/molAnantin (linear sequence) trifluoroacetate salt
CAS:<p>Please enquire for more information about Anantin (linear sequence) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C90H113N21O25Purity:Min. 95%Molecular weight:1,888.99 g/molMca-(endo-1a-Dap (Dnp))-TNF-a (-5 to +6) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-(endo-1a-Dap (Dnp))-TNF-a (-5 to +6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H103N23O24Purity:Min. 95%Molecular weight:1,638.7 g/molBoc-L-tyrosine methyl ester
CAS:<p>Boc-L-tyrosine methyl ester is a synthetic amino acid that can be used in the production of peptides and proteins. It has been shown to have a high uptake and hydroxyl group, which allows for the synthesis of dopamine. The kinetic study of Boc-L-tyrosine methyl ester in agarose gels has shown that it has a high affinity for dopamine. Boc-L-tyrosine methyl ester has also been used as an intermediate for the synthesis of peptides and proteins. It is not active against cancer cells but has been used to induce matrix metalloproteinase (MMP) activity in Mcf-7 cells.</p>Formula:C15H21NO5Purity:Min. 95%Color and Shape:White PowderMolecular weight:295.33 g/molAbz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H49N9O14Purity:Min. 95%Molecular weight:903.89 g/molH-Arg-Pro-pNA trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Arg-Pro-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H25N7O4Purity:Min. 95%Molecular weight:391.43 g/mol3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid
CAS:<p>3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is a polyphenol that can be found in plants and food. It has been shown to have antimicrobial properties against certain bacteria and fungi, such as Staphylococcus aureus, Clostridium perfringens, and Candida albicans. 3-(3-Bromo-4-hydroxy-5-methoxyphenyl)acrylic acid is synthesized by means of the condensation of p-coumaric acid with acrylic acid in the presence of a base catalyst. This compound undergoes biotransformations such as hydroxylation and oxidation to form 3-(3,4′-dihydroxyphenyl)acrylic acid (DHPAA). The compound is also able to react with other phenolic compounds such as cinnamic acid under certain conditions.</p>Formula:C10H9BrO4Purity:Min. 95%Color and Shape:PowderMolecular weight:273.08 g/molBoc-Ala-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Ala-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%N1-Glutathionyl-spermidine disulfide [
CAS:<p>N1-Glutathionyl-spermidine disulfide (N1-GS) is a molecule that has been shown to have clinical use in the treatment of chronic hepatitis C infection. The N1-GS molecule is composed of a glutathione (GSH) scaffold with two sulfhydryl groups and an amino acid side chain. N1-GS has a hydrophobic nature, which allows it to penetrate the cellular membrane and enter cells. It is also able to form hydrogen bonds and act as a catalyst for reactions. Fluorescence analysis revealed that this molecule is selective for disulfides over thiols, amines, or alcohols. Disulfides are very important in biological systems since they can be found in enzymes, proteins, and cellular membranes. The insolubility of the N1-GS molecule makes it difficult to analyze its structure using traditional methods such as gas chromatography or nuclear magnetic resonance spectroscopy. However, fluorescence</p>Formula:C34H66N12O10S2Purity:Min. 95%Molecular weight:867.09 g/molNeuromedin U-25 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H203N41O38Purity:Min. 95%Molecular weight:3,080.37 g/molGalanin (1-13)-Spantide I
CAS:<p>Spantide I is a peptide that is a member of the Galanin family. It has been shown to have a proliferative effect on retinal cells in vitro, and may be effective in treating diabetic retinopathy. Spantide I also inhibits the production of pancreatic enzymes and choroidal neovascularization. It is a diagnostic marker for cancer and other diseases, as well as being used in the treatment of hepatitis. The sequences for Spantide I are GG-S-P-A-N-T-I-D-E--I--H--Gly--Trp--Thr--Leu--Asn--Ser--Ala--Gly--Tyr--Leu--Leu---Gly---Pro---D----Arg---Pro-----Lys---Pro-------Gln-------D------Trp------Phe------D------Trp------Leu-------Leu-----NH2</p>Formula:C138H199N35O30Purity:Min. 95%Molecular weight:2,828.27 g/molLys-Lys-(Hyp 3,b-(2-thienyl)-Ala5·8,D-Phe7)-Bradykinin
CAS:<p>Please enquire for more information about Lys-Lys-(Hyp 3,b-(2-thienyl)-Ala5·8,D-Phe7)-Bradykinin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H95N19O14S2Purity:Min. 95%Molecular weight:1,394.67 g/molType A Allatostatin III
CAS:<p>Please enquire for more information about Type A Allatostatin III including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H62N10O12Purity:Min. 95%Molecular weight:899 g/molSubstance P (2-11)
CAS:<p>Substance P (2-11) H-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 is a peptide that is the product of proteolytic cleavage of substance P. It binds to the neurokinin receptor and induces degranulation in mast cells and sensory neurons. It has been used as a diagnostic tool for mast cell degranulation. Substance P (2-11) H-Pro-Lys-Pro-Gln-Gln-Phe has also been used to assess lung function in anesthetized animals, circulations in muscle, and changes in perfusion during surgical procedures.</p>Formula:C57H86N14O12SPurity:Min. 95%Molecular weight:1,191.45 g/molAc-Phe-Phe-OH
CAS:<p>Please enquire for more information about Ac-Phe-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H22N2O4Purity:Min. 95%Molecular weight:354.4 g/molH-Gly-D-Gln-OH
CAS:<p>H-Gly-D-Gln-OH is a chiral molecule that has been used to identify the presence of cholinergic receptors in ventricular myocytes. It is a substrate for the enzyme acetylcholinesterase, which breaks down acetylcholine, an important neurotransmitter. H-Gly-D-Gln-OH binds to nicotinic and muscarinic acetylcholine receptor sites in cardiac muscle cells and can be detected in platelet membranes after injection. The dose of H-Gly-D-Gln-OH that is injected into mice will depend on the animal's weight.</p>Formula:C7H13N3O4Purity:Min. 95%Molecular weight:203.2 g/mol(1-Adamantaneacetyl1,D-Tyr(Et)2,Val4, Abu 6, Arg8·9)-vasopressin
CAS:<p>(1-Adamantaneacetyl1,D-Tyr(Et)2,Val4, Abu 6, Arg8·9)-vasopressin is a vasopressor analog that has been shown to be an effective treatment for congestive heart failure by acting as an agonist at the V1 receptor. It has been shown to stimulate cyclase activity and increase levels of adenosine 3',5'-cyclic monophosphate (cAMP). This drug also stimulates the production of immunoglobulin A antibodies in mice and increases the expression of leucine aminopeptidase and immunofluorescence in rat kidney cells. Vasopressin analogs are used primarily for their vasoconstrictive properties.</p>Formula:C62H94N16O11Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:1,239.51 g/molL-Tyrosine methyl ester hydrochloride
CAS:<p>L-Tyrosine methyl ester hydrochloride is a synthetic compound that has been shown to have anti-thrombotic and anti-inflammatory properties. In particular, L-Tyrosine methyl ester hydrochloride inhibits the activity of thrombin, which is an enzyme involved in the coagulation process. It has also been shown to be effective against solid tumours and cell cultures. L-Tyrosine methyl ester hydrochloride is used as a pharmaceutical preparation for the treatment of osteoarthritis, rheumatoid arthritis, and other inflammatory disorders. It is also used as a precursor in the synthesis of amino acid compounds such as L-DOPA.</p>Formula:C10H14ClNO3Purity:Min. 95%Molecular weight:231.68 g/molH-Leu-Phe-NH2·HCl
CAS:<p>H-Leu-Phe-NH2·HCl is a peptide that has been shown to have antiviral and anticancer properties. It blocks the replication of viruses by interacting with the amino acid sequence on the virus’s outer layer, which prevents the virus from binding to cells. H-Leu-Phe-NH2·HCl has also been shown to have anticancer properties. This peptide stimulates cancer cells to produce proteins that are required for their growth and proliferation, leading to increased tumor size. The effectiveness of this drug is enhanced when combined with other cancer drugs, such as cisplatin or vinblastine. H-Leu-Phe-NH2·HCl also has an excellent safety profile and does not cause any toxicity in healthy cells or tissues.</p>Formula:C15H23N3O2·HClPurity:Min. 95%Molecular weight:313.82 g/molZ-Trp-Val-OH trifluoroacetic acid
CAS:<p>Please enquire for more information about Z-Trp-Val-OH trifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H27N3O5•CF3CO2HPurity:Min. 95%Molecular weight:437.49 g/molMyelin Basic Protein (85-99) Peptide Antagonist trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Basic Protein (85-99) Peptide Antagonist trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C70H114N18O21Purity:Min. 95%Molecular weight:1,543.76 g/molNeuropeptide S (1-10) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide S (1-10) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H68N14O14SPurity:Min. 95%Molecular weight:1,025.14 g/molFA-Phe-Val-NH2
CAS:<p>Please enquire for more information about FA-Phe-Val-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H25N3O4Purity:Min. 95%Molecular weight:383.44 g/mol2-Iodo-5-methoxybenzoic acid
CAS:<p>2-Iodo-5-methoxybenzoic acid is a macrocyclic compound that has been synthesized in the Wittig reaction. It was first prepared by catalyzed intramolecular aryl demethylation of 2-iodo-5-nitrobenzoic acid, followed by coupling with methyl vinyl ketone. The cytotoxic activity of this compound is due to its ability to inhibit the synthesis of protein and DNA and induce apoptosis. This molecule has been shown to be effective against liverworts and ethers.</p>Formula:C8H7IO3Purity:Min. 95%Color and Shape:PowderMolecular weight:278.04 g/molAngiotensin I (1-9) trifluoroacetate salt
CAS:<p>Please enquire for more information about Angiotensin I (1-9) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H78N16O13Purity:Min. 95%Molecular weight:1,183.32 g/molDynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about Dynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H95ClN20O12Purity:Min. 95%Molecular weight:1,323.98 g/mol3'-Hydroxy-4'-methoxyacetophenone
CAS:<p>3'-Hydroxy-4'-methoxyacetophenone is a chemical compound with the molecular formula CHO and it belongs to the group of bisbenzylisoquinoline alkaloids. It is a white crystalline powder that has a dry weight of 155.2g/mol and melting point of 154-158°C. 3'-Hydroxy-4'-methoxyacetophenone is used as an intermediate in the synthesis of other chemicals, such as methyl transferase inhibitors like metronidazole or oxidative stress agents like benzoquinones. 3'-Hydroxy-4'-methoxyacetophenone can be found in bowel disease patients, where it may be produced by bacteria in the gut. This chemical also has UV absorption properties and can be used as a sample preparation agent for hydroalcoholic samples.</p>Formula:C9H10O3Purity:Min. 95%Color and Shape:PowderMolecular weight:166.17 g/molFmoc-D-Arg(Pmc)-OPfp
CAS:<p>Please enquire for more information about Fmoc-D-Arg(Pmc)-OPfp including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H41F5N4O7SPurity:Min. 95%Molecular weight:828.85 g/molAc-D-Lys-OH
CAS:<p>Nicotinamide is a form of vitamin B3 that has been shown to inhibit the growth of Giardia lamblia trophozoites. Nicotinamide also inhibits the sirtuins and has been shown to inhibit cell cycle control in microorganisms. It inhibits transcriptional activity by competing with nicotinamide adenine dinucleotide for binding sites on DNA and prevents the formation of nicotinamide-adenine dinucleotide complexes, which are needed for DNA synthesis. Nicotinamide also binds to metronidazole, causing it to be inactive as an antimicrobial agent. The mechanism of action of nicotinamide may be due to its ability to bind and inactivate metronidazole, thereby preventing it from functioning as an anti-microbial agent.</p>Formula:C8H16N2O3Purity:Min. 95%Molecular weight:188.22 g/molH-Pro-Thr-His-Ile-Lys-Trp-Gly-Asp-OH
CAS:<p>H-Pro-Thr-His-Ile-Lys-Trp-Gly-Asp-OH is a potent inhibitor of platelet activation, which is induced by nitroprusside. In vitro studies have shown that this peptide inhibits the expression of growth factors, such as platelet derived growth factor (PDGF), and inhibits PDGF activity. This peptide also has an inhibitory effect on nitroprusside, which may be due to its ability to inhibit PDGF expression. The inhibition of PDGF by this peptide may result in the potentiation of the effects of nitroprusside on blood pressure.</p>Formula:C44H64N12O12Purity:Min. 95%Molecular weight:953.05 g/molFA-Phe-Lys-OH·HCl
CAS:<p>Please enquire for more information about FA-Phe-Lys-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H27N3O5•HClPurity:Min. 95%Molecular weight:449.93 g/molEntero-Kassinin
CAS:<p>Please enquire for more information about Entero-Kassinin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H89N15O21SPurity:Min. 95%Molecular weight:1,364.48 g/molBiotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H301N55O56S3Purity:Min. 95%Molecular weight:4,408.01 g/molZ-Gly-His-OH
CAS:<p>Please enquire for more information about Z-Gly-His-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H18N4O5Purity:Min. 95%Molecular weight:346.34 g/molNeurotensin (9-13)
CAS:<p>Neurotensin (NT) is a peptide hormone that belongs to the family of amides and is found in the stomach, small intestine, and central nervous system. NT is an agonist of the neurotensin receptor and binds to allosteric binding sites on the receptor. Neurotensin (NT) is modified by proteolysis, which may be due to its acidic residue at position 9. This modification leads to increased affinity for the neurotensin receptor binding site. The pharmacokinetic properties of NT are not well-understood as it has been shown to have both high lipophilicity and low plasma protein binding rates. Neurotensin (NT) receptors have been shown to be G protein coupled receptors with different subtypes, such as NT1, NT2A, NT2B, and NT3.</p>Formula:C32H52N8O7Purity:Min. 95%Molecular weight:660.81 g/molH-β-Ala-Leu-OH
CAS:<p>Please enquire for more information about H-beta-Ala-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H18N2O3Purity:Min. 95%Molecular weight:202.25 g/molBoc-Thr(Val-Fmoc)-OH
CAS:<p>Please enquire for more information about Boc-Thr(Val-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H36N2O8Purity:Min. 95%Molecular weight:540.6 g/molN-(4-Methoxybenzylidene)-4-butylaniline
CAS:<p>N-(4-Methoxybenzylidene)-4-butylaniline is an organic compound that belongs to the group of liquid crystals. It has been used in the study of phase transitions and thermal properties. The melting point of N-(4-methoxybenzylidene)-4-butylaniline is between -80 and -90 °C, depending on the solvent. This compound has a low proton affinity, but it can be oxidized to form a radical cation.</p>Formula:C18H21NOPurity:Min. 95%Molecular weight:267.37 g/molAc-Trp-Glu-His-Asp-AFC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Trp-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H37F3N8O11Purity:Min. 95%Molecular weight:838.74 g/molMetorphamide (free acid)
CAS:<p>Please enquire for more information about Metorphamide (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H68N14O10SPurity:Min. 95%Molecular weight:985.17 g/molZ-Val-Phe-OMe
CAS:<p>Z-Val-Phe-OMe is an efficient method for the synthesis of a benzyl ester, which is a precursor to the anti-leishmanial drug Z-Val-Phe. The reaction is carried out in chloroform in the presence of ethyl or benzyl esters and ammonium chloride. This methodology was developed to provide a systematic approach to synthesize this compound. The reaction proceeds through a serine protease catalyzed hydrolysis of the amide bond on the surface of leishmania. Kinetic data shows that Z-Val-Phe-OMe has an IC50 value of 0.87 μM for leishmania and is more active than Z-Val-Phe against L. major, L. mexicana, and L. braziliensis strains.</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/molZ-Tyr-Lys-Arg-pNA·2 TFA
CAS:<p>Z-Tyr-Lys-Arg-pNA·2 TFA is a potent inhibitor of proteases. It has been shown to be an efficient inhibitor of the major yeast protease, proteinase A, and other enzymes that are used for the industrial production of peptides. Z-Tyr-Lys-Arg-pNA·2 TFA is a synthetic peptide with a molecular mass of 5,836 Da and an optimum pH of 7.5. This peptide is synthesized by the chemical reaction between butoxycarbonyl (Boc) Lys(Z)-Tyr(N)-Arg(R)-pNA and 2 equivalents of trifluoroacetic acid (TFA). The synthesis takes place in a homogenous solution in dichloromethane at room temperature in the presence of triethylamine as base. Filtration through a 0.22 μm filter removes any insoluble impurities from the solution.</p>Formula:C35H45N9O8·2C2HF3O2Purity:Min. 95%Molecular weight:947.83 g/molAnthranilyl-HIV Protease Substrate V trifluoroacetate salt
CAS:<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate V trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H76N14O13Purity:Min. 95%Molecular weight:1,081.23 g/mol([ring-D5]Phe6)-Somatostatin-14
<p>Please enquire for more information about ([ring-D5]Phe6)-Somatostatin-14 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C76H99D5N18O19S2Purity:Min. 95%Molecular weight:1,642.91 g/molH-Gly-Ala-NH2·HCl
CAS:<p>Please enquire for more information about H-Gly-Ala-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H11N3O2·HClPurity:Min. 95%Molecular weight:181.62 g/molFmoc-Pro-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Pro-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(H-Cys-4MbNA)2 acetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-4MbNA)2 acetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H30N4O4S2Purity:Min. 95%Molecular weight:550.69 g/mol(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)
CAS:<p>Please enquire for more information about (Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H303N59O53Purity:Min. 95%Molecular weight:4,309.85 g/molKemptide trifluoroacetate salt
CAS:<p>Kemptide is a substrate molecule that has been shown to inhibit the enzyme activity of some protein kinases. Kemptide is a 3-amino acid peptide that contains the amino acids L-leucine, L-arginine, and L-arginine. It was originally isolated from an extract of human brain tissue and has been shown to inhibit the activity of protein kinase C (PKC), phosphorylase kinase, and glycogen synthase kinase 3β in vitro assays. Kemptide also inhibits the expression of genes encoding PKCα1, PKCα2, PKCδ, PKCε, PKCγ1, PKCγ2, PKCζ in t84 cells. The inhibition of these genes suggests that kemptide may be useful as a drug candidate for inhibiting protein kinases in vivo.</p>Formula:C32H61N13O9·xC2HF3O2Purity:Min. 95%Molecular weight:771.91 g/molTrypsin-Modulating Oostatic Factor (Neobelliera bullata)
CAS:<p>Proctolin is a peptide hormone that regulates the growth of the ovary. Proctolin has been found to be a proteolytic molecule that specifically cleaves at the carboxy-terminal end of the protein substrate. It also has inhibitory effects on the activity of carboxypeptidase, an enzyme involved in the digestion and absorption of proteins. Proctolin has been shown to modulate biological studies, such as nitrogen atoms and sequences, which may be due to its ability to regulate and stimulate biosynthesis.</p>Formula:C29H46N10O10Purity:Min. 95%Molecular weight:694.74 g/molGuanylin (human)
CAS:<p>Please enquire for more information about Guanylin (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H87N15O21S4Purity:Min. 95%Molecular weight:1,458.66 g/mol2-Methoxy-5-[[(phenylmethyl)sulfonyl]methyl]benzenamine
CAS:<p>3-Amino-4-methoxybenzyl sulphone is a high quality, versatile building block that is used in the synthesis of complex compounds. It is a reagent that can be used for reactions such as the coupling of amines and carboxylic acids. 3-Amino-4-methoxybenzyl sulphone is also useful in the synthesis of pharmaceuticals and speciality chemicals. The compound has been shown to react with other substances, such as thiols and alcohols, to form new materials with interesting properties.</p>Formula:C15H17NO3SPurity:Min. 95%Color and Shape:PowderMolecular weight:291.37 g/molNeuropeptide VF (124-131) (human) trifluoroacetate salt
CAS:<p>Neuropeptide VF (124-131) (human) trifluoroacetate salt H-Val-Pro-Asn-Leu-Pro-Gln-Arg-Phe-NH2 trifluoroacetate salt is a peptide that is synthesized in the hypothalamus and is involved in the regulation of gonadotropin secretion. It has been shown to inhibit cell growth in vitro and to have an inhibitory effect on cancer cells. This peptide also binds to receptors α, adenohypophyseal, cellular, testicular, vasoactive intestinal peptide, messenger RNA, estradiol benzoate, cancer, and progesterone receptor.</p>Formula:C45H72N14O10Purity:Min. 95%Molecular weight:969.14 g/molN-Me-Abz-Amyloid β/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about N-Me-Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C70H116N26O18Purity:Min. 95%Molecular weight:1,609.83 g/molN-Methyl-DL-alanine
CAS:<p>N-Methyl-DL-alanine is an amino acid that is also known as d-alanine. It is a precursor for the synthesis of other amino acids such as histidine, methionine, and arginine. N-Methyl-DL-alanine is found in the mitochondria of cells and plays a role in energy metabolism. It has been shown to be taken up by cells through an active transport process and can act as a competitive inhibitor of mitochondrial uptake. At physiological concentrations, N-methyl DL-alanine inhibits fatty acid oxidation by decreasing the activity of carnitine palmitoyltransferase I (CPT I) and enhancing lipid accumulation in the liver. N-Methyl DL-alanine has been shown to inhibit cycloleucin A production by acting as an inhibitor of fatty acid synthase (FAS).</p>Formula:C4H9NO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:103.12 g/molFmoc-[ring-D5]Phe-OH
CAS:Controlled Product<p>Please enquire for more information about Fmoc-[ring-D5]Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H16D5NO4Purity:Min. 95%Molecular weight:392.46 g/molH-Asp(OtBu)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Asp(OtBu)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-Tyr(PO3(MDPSE)2)-OH
CAS:<p>Please enquire for more information about Fmoc-Tyr(PO3(MDPSE)2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H54NO8PSi2Purity:Min. 95%Molecular weight:932.15 g/mol(D-Trp6,D-Leu7)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molN-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester
CAS:<p>Intermediate in the synthesis of tedizolid</p>Formula:C21H17FN6O2Purity:Min. 95%Molecular weight:404.4 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molH-Ala-His-Lys-OH acetate salt
CAS:<p>H-Ala-His-Lys-OH acetate salt is a copper complex that has been shown to have antioxidant properties in vitro. It has been studied for use as an analog of the vitamin C, which is a cofactor for collagen synthesis and follicular keratinization. Copper complexes with H-Ala-His-Lys-OH acetate salt have been shown to inhibit the formation of reactive oxygen species (ROS) and to stimulate collagen production by human dermal fibroblasts in vitro. This compound also stimulates the growth of human skin cells in vitro, which may be due to its ability to induce fibroblast proliferation.</p>Formula:C15H26N6O4Purity:Min. 95%Molecular weight:354.4 g/molBoc-His(1-Mts)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-His(1-Mts)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H27N3O6S·C12H23NPurity:Min. 95%Molecular weight:618.83 g/molH-Tyr-Lys-Thr-OH
CAS:<p>Please enquire for more information about H-Tyr-Lys-Thr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H30N4O6Purity:Min. 95%Molecular weight:410.46 g/mol(D-Trp8)-γ2-MSH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp8)-gamma2-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H99N21O16SPurity:Min. 95%Molecular weight:1,570.78 g/molH-Gly-Phe-Tyr-OH
CAS:<p>H-Gly-Phe-Tyr-OH is a water soluble polymer that can be conjugated to drugs. The polymer is composed of methacrylamide and Gly, Phe, and Tyr residues. This polymer is used in the treatment of cancer by conjugating a drug to the polymer to make it water soluble. H-Gly-Phe-Tyr-OH can also be used as a polymeric carrier for docetaxel or gemcitabine.</p>Formula:C20H23N3O5Purity:Min. 95%Molecular weight:385.41 g/molBiotinyl-Obestatin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C124H188N36O33SPurity:Min. 95%Molecular weight:2,743.11 g/mol3-Iodo-2-methylbenzoic acid
CAS:<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>Formula:C8H7IO2Purity:Min. 95%Color and Shape:SolidMolecular weight:262.04 g/molDansyl-Tyr-Val-Gly-OH trifluoroacetate salt
CAS:<p>Dansyl-Tyr-Val-Gly-OH trifluoroacetate salt is a glyoxylate analog that can be used as a substrate in the kinetic assays for glyoxalase I. The enzyme catalyses the conversion of this compound to Dansylglyoxal, which can be detected by absorbance at 360 nm. The second order rate constant and acidic pH of the reaction have been determined using biophysical experiments and expressed as a function of substrate concentration. Inactivates papilloma virus, which is the virus that causes genital warts, at low concentrations.</p>Formula:C28H34N4O7SPurity:Min. 95%Molecular weight:570.66 g/molH-Met-Thr-OH
CAS:<p>Met-Thr-OH is a peptide binding inhibitor that is used as a research tool for determining the role of metalloproteins in vivo. Methionine aminopeptidase (MetAP) is an enzyme that cleaves methionine from protein and peptides and has been shown to play a vital role in cancer progression. MetAP has been shown to be inhibited by Met-Thr-OH, which binds to the enzyme's active site and blocks its activity. The inhibition of MetAP limits the production of proteins involved in cell growth and proliferation, leading to reductions in tumor size. This inhibition may also be due to the inhibition of other functional groups such as phosphorylation, dephosphorylation, or nitrosylation.</p>Formula:C9H18N2O4SPurity:Min. 95%Molecular weight:250.32 g/molH-D-Leu-bNA·HCl
CAS:<p>Please enquire for more information about H-D-Leu-bNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H20N2O·HClPurity:Min. 95%Molecular weight:292.8 g/molH-Ser-AMC hydrochloride salt
CAS:<p>Please enquire for more information about H-Ser-AMC hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H14N2O4Purity:Min. 95%Molecular weight:262.26 g/molH-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt (HGGDS) is a collagen gel that is used in the treatment of autoimmune diseases, such as arthritis and lupus. HGGDS inhibits the production of fibrinogen, which is a protein involved in blood clotting, by binding to its receptor on human fibroblasts. It also inhibits the production of basic proteins needed for the generation of collagen and activation of integrin receptors, which are involved in cell adhesion and migration. HGGDS also blocks transcription polymerase chain reactions (PCRs), which are necessary for the synthesis of DNA. This can lead to a decrease in cell proliferation and an increase in apoptosis.</p>Formula:C22H37N9O10Purity:Min. 95%Molecular weight:587.58 g/mol4,6-Dichloro-2-methylnicotinic acid
CAS:<p>Please enquire for more information about 4,6-Dichloro-2-methylnicotinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%LHRH (7-10)·2 HCl
CAS:<p>Please enquire for more information about LHRH (7-10)·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H36N8O4·2HClPurity:Min. 95%Molecular weight:513.46 g/molZ-Val-D-Phe-OMe
CAS:<p>Please enquire for more information about Z-Val-D-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/mol5-Iodo-2-methoxybenzyl alcohol
CAS:<p>5-Iodo-2-methoxybenzyl alcohol (5IMB) is a conjugate that inhibits tubulin polymerization and mitochondrial membrane integrity. It has significant inhibitory effects on colchicine-induced apoptosis in colon cancer cells, inducing apoptotic cell death by the activation of caspase 3 and annexin. 5IMB also has an inhibitory effect on mitochondria, leading to mitochondrial membrane depolarization and apoptotic cell death. This conjugate also induces the death of human cancer cells, specifically mcf-7, which are involved in tumour growth and metastasis. The mechanism of action for 5IMB is through its ability to induce mitochondrial membrane depolarization, leading to apoptotic cell death.</p>Formula:C8H9O2IPurity:Min. 95%Molecular weight:264.06 g/molH-Ser-Asp-Gly-Arg-Gly-OH
CAS:<p>H-Ser-Asp-Gly-Arg-Gly-OH is a peptide and model system for epidermal growth factor. It has been shown to stimulate epidermal growth and protein synthesis in the skin cells. The peptide has also been shown to inhibit fibrinogen production by monoclonal antibody, which is a biochemical marker of wound healing. H-Ser-Asp-Gly-Arg-Gly-OH analogs have been shown to inhibit the activation of epidermal growth factor receptor and have an inhibitory effect on cell growth.</p>Formula:C17H30N8O9Purity:Min. 95%Molecular weight:490.47 g/mol2-(Chloromethyl)-4-methoxy-3,5-dimethylpyridine hydrochloride
CAS:<p>2-(Chloromethyl)-4-methoxy-3,5-dimethylpyridine hydrochloride is a benzimidazole derivative. It has a chemical stability and can be used for wastewater treatment. It is also a pump inhibitor and can be used for anhydrous sodium magnesium salts. This product is synthesized from the reaction of protonated 2-bromo-4-methoxyphenol with 2,6-dimethylpyridine in the presence of hydrochloric acid. The reaction was carried out in an asymmetric synthesis using a proton transport system. 2-(Chloromethyl)-4-methoxy-3,5-dimethylpyridine hydrochloride is soluble in water and has a pH of 1 to 3. It has been shown that this product can be used as an antioxidant and as a metal chelation agent.</p>Formula:C9H13Cl2NOPurity:Min. 95%Color and Shape:PowderMolecular weight:222.11 g/molNesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C167H260N40O54Purity:Min. 95%Molecular weight:3,692.09 g/molNeuromedin S (human) trifluoroacetate salt
<p>Please enquire for more information about Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H265N53O44Purity:Min. 95%Molecular weight:3,791.29 g/molPrepro VIP (81-122) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C202H325N53O64SPurity:Min. 95%Molecular weight:4,552.13 g/molN-Methyl-2-fluoro-4-aminobenzamide
CAS:<p>N-Methyl-2-fluoro-4-aminobenzamide is a toxic compound that is commonly used as a reagent in chemical synthesis and research. It has been studied for its potential use in medicine, particularly in the treatment of castration-resistant prostate cancer. N-Methyl-2-fluoro-4-aminobenzamide acts as a nucleophilic agent, participating in reactions that involve the addition of an acyl group to a target molecule. Its stable formyl group allows for efficient reaction yields and reliable results. However, due to its toxic nature, caution must be exercised when handling this compound.</p>Formula:C8H9FN2OPurity:Min. 95%Molecular weight:168.17 g/molFmoc-b-Ala-Ala-Pro-OH
CAS:<p>Fmoc-b-Ala-Ala-Pro-OH is a reaction component that can be used in the synthesis of peptides and other compounds. It is a building block for the preparation of complex compounds, such as small molecules, polymers and natural products. Fmoc-b-Ala-Ala-Pro-OH has been shown to be useful in the synthesis of various types of reagents, including antibiotics and pharmaceuticals. This chemical has been reported as a useful scaffold for the preparation of high quality research chemicals. Fmoc-b-Ala-Ala-Pro is also an intermediate in the synthesis of speciality chemicals and fine chemicals.</p>Formula:C26H29N3O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:479.53 g/mol(D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H100N22O14S3Purity:Min. 95%Molecular weight:1,449.77 g/molSapecin
CAS:<p>Sapecin is an antimicrobial peptide, which is derived from the hemolymph of the silk moth (Bombyx mori) with potent bactericidal action. The source of Sapecin is the immune system of the silk moth, where it acts as a natural defense mechanism against microbial infections. Its mode of action involves disrupting bacterial cell membranes, leading to cell lysis and death. The peptide achieves this by inserting itself into the lipid bilayer, creating pores that compromise the structural integrity of the membrane.</p>Formula:C164H266N58O52S6Purity:Min. 95%Molecular weight:4,074.62 g/molSuc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid
CAS:<p>Suc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid is a synthetic peptide that has been shown to have the ability to inhibit the function of an enzyme called isomerase. It binds to the catalytic region of the enzyme and blocks its activity, which prevents the production of amino acid molecules. Suc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid also has immunosuppressive properties, which are due to its ability to bind to regulatory domains in cells and prevent their transcriptional activation. This molecule also has a catalytic function and can be used as a building block for synthesizing other molecules with similar functions.</p>Formula:C37H45N5O9•xCF3CO2HPurity:Min. 95%Molecular weight:703.78 g/mol(S)-(-)-3-Chloro-1-phenyl-1-propanol
CAS:<p>(S)-(-)-3-Chloro-1-phenyl-1-propanol is an efficient method for the synthesis of chiral propiophenone. It is synthesized by reacting a mixture of borane and tetrahydrofuran with (S)-(-)-3-chloro-1-phenylpropanol. This reaction produces the desired compound in good yield and high diastereoselectivity. The synthesis of this compound has been shown to be useful for the production of antidepressant drugs, such as κ-opioid receptor ligands, which are used to treat depression, anxiety, and chronic pain.</p>Formula:C9H11ClOPurity:Min. 95%Molecular weight:170.64 g/molPreptin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Preptin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C187H275N47O53Purity:Min. 95%Molecular weight:4,029.47 g/molFibronectin CS-1 Fragment (1978-1982)
CAS:<p>Fibronectin CS-1 Fragment (1978-1982) H-Glu-Ile-Leu-Asp-Val-OH is a heterocyclic peptide that has inhibitory effects on the muscle cells. It inhibits the enzyme guanosine triphosphatase, which is responsible for releasing calcium ions from its intracellular storage site. Fibronectin CS-1 Fragment (1978-1982) H-Glu-Ile-Leu-Asp-Val-OH is an analog of the human protein fibronectin, and it can be used as a synthetic molecule to study how integrin receptors interact with different sequences of amino acids.</p>Formula:C26H45N5O10Purity:Min. 95%Molecular weight:587.66 g/molPeptide 74
CAS:<p>Peptide 74 is a synthetic drug that has been shown to inhibit the activity of matrix metalloproteinases, which are enzymes that break down collagen in the extracellular matrix. This peptide also inhibits cell invasiveness and migration. It has been shown to be effective at inhibiting cancer cell growth, although it does not affect normal cells. The peptide is a receptor for the LDL-receptor and inhibits LDL uptake into macrophages. The peptides have also been shown to inhibit angiogenesis and tumor growth in animals by blocking VEGF receptors.</p>Formula:C62H107N23O20S2Purity:Min. 95%Molecular weight:1,558.79 g/molTos-Gly-Pro-Lys-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Tos-Gly-Pro-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H37N5O7SPurity:Min. 95%Molecular weight:611.71 g/mol4-Formyl-phenyloxymethyl polystyrene resin (200-400 mesh)
<p>4-Formylphenyloxymethyl polystyrene resin (200-400 mesh) is a polymer that can be used in the synthesis of amide, aminoacylation, halides, piperidine, yields, imine, reductive amination and heterocycles. It has been shown to be especially useful for the synthesis of diazepinones. The resin is soluble in solvents such as dichloromethane and ethanol. 4-Formylphenyloxymethyl polystyrene resin can be prepared by reacting styrene with formaldehyde and phenol in a solvent such as tetrahydrofuran or pyridine at a temperature between 0°C and 50°C. This process is usually conducted under an inert atmosphere such as nitrogen or argon gas. The resin is then washed with diethylether followed by benzene to remove residual formaldehyde.</p>Purity:Min. 95%Boc-Lys(2-chloro-Z)-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Lys(2-chloro-Z)-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%IQB-782
CAS:<p>IQB-782 is a mucolytic agent with mucolytic expectorant activity for the study of obstructive lung disease.</p>Formula:C4H9N3O2SPurity:>99.99%Color and Shape:SolidMolecular weight:163.2RFRP-3 (rat)
CAS:<p>Please enquire for more information about RFRP-3 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C88H134N26O25S2Purity:Min. 95%Molecular weight:2,020.3 g/molH-Phe-Arg-Arg-OH acetate salt
CAS:<p>The H-Phe-Arg-Arg-OH acetate salt is a reversible (acetylcholinesterase inhibitor). It reversibly binds to the enzyme, acetylcholinesterase and blocks the breakdown of acetylcholine, which is an important neurotransmitter. The H-Phe-Arg-Arg-OH acetate salt has been shown to be effective against rat hearts that have been damaged by lysosomal enzymes. This drug can also act as an endogenous buffer in the blood plasma, preventing changes in pH due to acidosis or alkalosis. The H-Phe-Arg-Arg-OH acetate salt is a subcomponent of citrate and myocardial proteins, which are essential for biosynthetic processes in the body. It has been shown to be maximally additive with other drugs that affect cardiac function, such as beta blockers and digitalis glycosides. Proteolysis is maximally inhibited by this drug when it</p>Formula:C21H35N9O4Purity:Min. 95%Molecular weight:477.56 g/molBoc-L-glutamic acid γ-methyl ester
CAS:<p>Boc-L-glutamic acid gamma-methyl ester is a conjugate of glutamic acid and methyl ester. It has been shown to have neuroprotective properties by inhibiting the hydrophobic effect, which is the driving force for protein aggregation. This drug can be used as a treatment for neurodegenerative diseases such as Alzheimer's disease, Parkinson's disease, and Huntington's disease. Boc-L-glutamic acid gamma-methyl ester binds with an alkyl group to the glutamate residue on the side chain of a model protein. The fluoroquinolone was found to be more potent than other drugs in this class because it has a higher affinity for glutamate residues.</p>Formula:C11H19NO6Purity:Min. 95%Molecular weight:261.27 g/molLHRH (free acid) trifluoroacetate salt
CAS:<p>LHRH (free acid) trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-OH trifluoroacetate salt is a decapeptide that is the most potent form of the hormone luteinizing hormone releasing hormone (LHRH). It has been shown to bind to surface receptors and activate a G protein, which activates adenyl cyclase. This leads to increased levels of cyclic adenosine monophosphate (cAMP) in cells. LHRH also binds to blood vessels and causes vasodilation. LHRH also binds to pyroglutamic acid, which is an amino acid found in peptides that have affinity for peptidases. This binding causes the release of peptidases from the cell membrane, uncovers receptor sites, and increases cAMP production. LHRH has also been shown to inhibit kidney function</p>Formula:C55H74N16O14Purity:Min. 95%Molecular weight:1,183.28 g/molFmoc-Tyr(tBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Tyr(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-Val-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Val-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%GM-CSF (17-31)
CAS:<p>Please enquire for more information about GM-CSF (17-31) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H129N27O24Purity:Min. 95%Molecular weight:1,768.97 g/molH-Lys-Thr-Tyr-OH
CAS:<p>Please enquire for more information about H-Lys-Thr-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H30N4O6Purity:Min. 95%Molecular weight:410.46 g/mol(N-Me-D-Phe7)-Bradykinin
CAS:<p>Please enquire for more information about (N-Me-D-Phe7)-Bradykinin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H77N15O11Purity:Min. 95%Molecular weight:1,124.29 g/molH1-7 acetate salt
CAS:<p>H1-7 acetate salt H-Arg-Arg-Lys-Ala-Ser-Gly-Pro-OH acetate salt is a synthetic, ternary complex of the amino acid histidine, arginine and lysine. It has been shown to inhibit β lactamase enzymes that are responsible for the hydrolysis of penicillin, cephalosporin, and monobactam antibiotics. The inhibition is due to the hydrophobic nature of the substrate binding site on β lactamase. This binding prevents the enzyme from hydrolyzing its substrate and inactivates it. In addition, H1-7 acetate salt H-Arg-Arg-Lys-Ala-Ser-Gly-Pro-OH acetate salt binds to calcium ions and has been shown to have a kinetic effect on β lactamases.</p>Formula:C31H58N14O9Purity:Min. 95%Molecular weight:770.88 g/molLQEQ-19 (human) trifluoroacetate salt
<p>Please enquire for more information about LQEQ-19 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C106H170N30O34Purity:Min. 95%Molecular weight:2,408.67 g/molH-Lys-Lys-Arg-Ala-Ala-Arg-Ala-Thr-Ser-Asn-Val-Phe-Ala-NH2
CAS:<p>Please enquire for more information about H-Lys-Lys-Arg-Ala-Ala-Arg-Ala-Thr-Ser-Asn-Val-Phe-Ala-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H107N23O16Purity:Min. 95%Molecular weight:1,418.65 g/molMast Cell Degranulating (MCD) Peptide HR-2
CAS:<p>Please enquire for more information about Mast Cell Degranulating (MCD) Peptide HR-2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H135N17O14Purity:Min. 95%Molecular weight:1,523 g/molNeuropeptide Y (3-36) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (3-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C176H271N53O54Purity:Min. 95%Molecular weight:3,993.36 g/mol(D-Tyr5,D-Ser(tBu)6,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (D-Tyr5,D-Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O14Purity:Min. 95%Molecular weight:1,269.41 g/molNeuropeptide W-30 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide W-30 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H249N49O38SPurity:Min. 95%Molecular weight:3,559.12 g/mol4-Nitro-Z-Gly-Trp-Gly-OH
CAS:<p>Please enquire for more information about 4-Nitro-Z-Gly-Trp-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H23N5O8Purity:Min. 95%Molecular weight:497.46 g/molZ-Gly-Gly-Gly-Gly-Gly-Gly-OH
CAS:<p>Please enquire for more information about Z-Gly-Gly-Gly-Gly-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H26N6O9Purity:Min. 95%Molecular weight:494.46 g/molSuc-Leu-Tyr-AMC
CAS:<p>AMC conjugated molecule targeting chymotrypsin-like peptidase, calpain I and II and papain, and Ti protease from E. coli</p>Formula:C29H33N3O8Purity:Min. 95%Molecular weight:551.59 g/molZ-Phe-Leu-Glu-pNA
CAS:<p>Z-Phe-Leu-Glu-pNA is a synthetic substrate for proteolytic enzymes. This peptide is an optimal substrate for polymerase chain reaction (PCR) due to its high concentration of serine and reactive site. Z-Phe-Leu-Glu-pNA has been used as a synthetic substrate in the study of proteolytic enzymes, including trypsin treatment, subtilisin and chymotrypsin. This peptide has also been studied in clinical trials as a potential treatment for hormone disorders such as prostate cancer and breast cancer.</p>Formula:C34H39N5O9Purity:Min. 95%Color and Shape:PowderMolecular weight:661.7 g/molAcetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt
CAS:<p>Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu-NH2 trifluoroacetate salt is a prophylactic and/or therapeutic compound that has been shown to be effective in the treatment of a number of different diseases. This compound has been shown to have neuroprotective and antiinflammatory effects, as well as being an effective treatment for autoimmune disorders. Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu NH2 trifluoroacetate salt also has the potential to be used as a prophylactic or therapeutic agent against cancer, fibrotic disease, and inflammatory disease.</p>Formula:C41H57N13O8Purity:Min. 95%Molecular weight:859.97 g/molH-Arg-Ala-OH acetate salt
CAS:<p>H-Arg-Ala-OH acetate salt (HAA) is a histidine analogue that has been found to have physiological function as an endogenous substrate for serine protease. HAA acts as a competitive inhibitor of the serine protease enzyme by binding to the active site serine in the active site. The molecule is a disulfide bond and can be synthesized by the microorganism Corynebacterium glutamicum. This salt was extracted from yellowtail and found to inhibit corynebacterium glutamicum. X-ray absorption studies showed that the molecule contains a single amino acid, which is an analog of histidine.</p>Formula:C9H19N5O3Purity:Min. 95%Molecular weight:245.28 g/molWRW4
CAS:<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H65N15O6Purity:Min. 95%Molecular weight:1,104.27 g/molMAGE-3 Antigen (168-176) (human) acetate salt
CAS:<p>Please enquire for more information about MAGE-3 Antigen (168-176) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C48H71N11O15Purity:Min. 95%Molecular weight:1,042.14 g/mol(d(CH2)51,D-Ile2,Ile4,Arg8,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disulfide bond)
CAS:<p>Please enquire for more information about (d(CH2)51,D-Ile2,Ile4,Arg8,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H79N13O10S2Purity:Min. 95%Molecular weight:1,086.38 g/molFluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H47FN6O14Purity:Min. 95%Molecular weight:914.89 g/molAdrenomedullin (26-52) (human)
CAS:<p>Please enquire for more information about Adrenomedullin (26-52) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H216N40O42Purity:Min. 95%Molecular weight:3,119.45 g/molH-Trp-Trp-OH
CAS:<p>H-Trp-Trp-OH is a reaction product of the amino acid tryptophan and various electron donors. The radical form of H-Trp-Trp-OH has been studied using 2D nuclear magnetic resonance (NMR) spectroscopy to determine its structure. In addition, H-Trp-Trp-OH has been used to study the mechanism of protein phosphorylation reactions. This chemical can be prepared from a solution of tryptophan in water and an oxidizing agent such as hydrogen peroxide or sodium hypochlorite. The frequency shift observed for H-Trp-Trp-OH was attributed to the presence of a constant that was found to be 10 Hz/M, indicating that this substance is a radical form. The sample preparation technique used in this experiment consisted of adding an equal volume of acetic acid to an unknown sample and then centrifuging it at 5000 rpm for five minutes before measuring its fluorescence emission.</p>Formula:C22H22N4O3Purity:Min. 95%Molecular weight:390.44 g/molN-α,ε-bis-Z-L-Lysine N-hydroxysuccinimide ester
CAS:<p>N-alpha,epsilon-bis-Z-L-Lysine N-hydroxysuccinimide ester is a methyl ester of the amino acid Lysine. This drug has been shown to have antinociceptive effects in animal models and may be useful for the treatment of inflammatory pain. The active conformation of this drug is dependent on the presence of hydroxybenzimidazole (HOBt). In the absence of HOBt, the compound does not have any activity. Acetylation or amidation may also affect its activity. The reaction with nitric acid yields a nitro derivative, which can be reduced back to the original compound by catalytic hydrogenation using palladium on carbon. A carboxylic acid group at the amino terminus can be converted to an amide or amido group by treatment with an appropriate reagent such as acetonitrile. This drug binds to a catalytic site on</p>Formula:C26H29N3O8Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:511.52 g/molH-Met-Trp-OH
CAS:<p>H-Met-Trp-OH is a synthetic compound that exhibits a suppressive effect on the labialis muscle. The mechanism of action is not fully understood, but it has been shown to have antioxidant function, and the antioxidant system in rat skin was found to be activated when H-Met-Trp-OH was applied. H-Met-Trp-OH also exhibits an antiinflammatory effect on dermatosis. This substance is structurally related to cinnamic acid derivatives, which are flavonoids with antioxidant properties.</p>Formula:C16H21N3O3SPurity:Min. 95%Molecular weight:335.42 g/molp60 v-src (137-157)
CAS:<p>Please enquire for more information about p60 v-src (137-157) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C111H168N30O35Purity:Min. 95%Molecular weight:2,482.7 g/mol(Phenylac 1,D-Tyr(Me)2,Arg6·8,Tyr-NH29)-Vasopressin trifluoroacetate salt Phenylac-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-Tyr-NH2 tri
CAS:<p>Please enquire for more information about (Phenylac 1,D-Tyr(Me)2,Arg6·8,Tyr-NH29)-Vasopressin trifluoroacetate salt Phenylac-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-Tyr-NH2 tri including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H83N17O13Purity:Min. 95%Color and Shape:PowderMolecular weight:1,274.43 g/molAc-Val-Tyr-Leu-Lys-Ala-SBzl
CAS:<p>Please enquire for more information about Ac-Val-Tyr-Leu-Lys-Ala-SBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H56N6O7SPurity:Min. 95%Molecular weight:740.95 g/molZ-Gly-Pro-Arg-AMC·HCl
CAS:<p>Please enquire for more information about Z-Gly-Pro-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H37N7O7·HClPurity:Min. 95%Molecular weight:656.13 g/molAtrial Natriuretic Factor (3-28) (rat) trifluoroacetate salt
CAS:<p>Natriuretic factor is a peptide hormone that regulates blood pressure. This peptide is encoded by a gene located on chromosome 10 and is made up of 28 amino acids. Natriuretic factor binds to the membrane of mitochondria and zymogen granules, causing them to release their contents into the cytosol. The resulting increase in cytosolic volume causes an increased diastolic pressure, as well as an increased glomerular filtration rate and cardiac output. Natriuretic factors have also been shown to stimulate the production of natriuretic peptides, which are involved in water balance and electrolyte homeostasis.</p>Formula:C119H189N43O36S2Purity:Min. 95%Molecular weight:2,862.17 g/molH-Arg-Asn-NH2 sulfate salt
CAS:<p>Please enquire for more information about H-Arg-Asn-NH2 sulfate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H21N7O3Purity:Min. 95%Molecular weight:287.32 g/molBoc-Gly-Gly-Gly-Lys-OH
CAS:<p>Please enquire for more information about Boc-Gly-Gly-Gly-Lys-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H31N5O7Purity:Min. 95%Molecular weight:417.46 g/molAc-Asp-Arg-Leu-Asp-Ser-OH
CAS:<p>Ac-Asp-Arg-Leu-Asp-Ser-OH is a peptide that has been synthesized to mimic the activity of aspartic acid. It has been shown to have prophylactic and/or therapeutic effects on infectious diseases and autoimmune diseases. Ac-Asp-Arg-Leu-Asp-Ser-OH may be used for the treatment of cancer, inflammatory diseases, and neurodegenerative diseases. Ac-Asp-Arg-Leu-Asp-Ser OH also acts as a cryoprotectant and diluent in drug development.</p>Formula:C25H42N8O12Purity:Min. 95%Molecular weight:646.65 g/molH-Leu-Leu-NH2·HCl
CAS:<p>Please enquire for more information about H-Leu-Leu-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H25N3O2·HClPurity:Min. 95%Molecular weight:279.81 g/mol(H-Asp-Glu-Val-Asp)2-Rhodamine 110 trifluoroacetate salt
CAS:<p>Please enquire for more information about (H-Asp-Glu-Val-Asp)2-Rhodamine 110 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H66N10O23Purity:Min. 95%Molecular weight:1,247.18 g/molH-Ala-Pro-Phe-OH
CAS:<p>Please enquire for more information about H-Ala-Pro-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23N3O4Purity:Min. 95%Molecular weight:333.38 g/molBAM-22P (8-22) trifluoroacetate salt
CAS:<p>BAM-22P (8-22) trifluoroacetate salt is a compound that has been shown to be an effective drug for the treatment of pain. It has been shown to have an effect on bone cancer, which can be activated by serotonin. This compound may be beneficial in treating nerve injury and fibrosarcoma cells. BAM-22P (8-22) trifluoroacetate salt is an allosteric modulator of the serotonin receptor and may be used as a treatment for pain in wild-type mice. The molecule is also a serotonin reuptake inhibitor, which prevents the reuptake of serotonin into the presynaptic neuron. This leads to increased levels of serotonin in the synapse and increased pain relief.</p>Formula:C91H127N25O23SPurity:Min. 95%Molecular weight:1,971.2 g/molN-Benzoyl-(2R,3S)-3-amino-2-hydroxy-3-phenyl-propionicacid
CAS:<p>N-Benzoyl-(2R,3S)-3-amino-2-hydroxy-3-phenylpropionic acid (BAPA) is a substance that is used in the manufacture of various drugs. It is also a potent anticancer drug that can be used for the treatment of cancer. BAPA has been shown to be an effective chemotherapeutic agent against many types of cancer cells. This drug is synthesized through an asymmetric synthesis process and has been shown to have potent cytotoxic effects against cancer cells with low levels of glutathione peroxide reductase. BAPA also inhibits the growth of bacteria by hydrolyzing or oxidizing proteins or by binding to DNA and RNA.</p>Formula:C16H15NO4Purity:Min. 95%Molecular weight:285.29 g/mol4-Biphenylac-Cys(Me)-D-Arg-Phe-(2-phenylethyl)amide
CAS:<p>4-Biphenylac-Cys(Me)-D-Arg-Phe-(2-phenylethyl)amide is a tetrapeptide that has been shown to have antihypertensive properties. This drug binds to the regulatory proteins of the renin angiotensin system and blocks the production of angiotensin II, which decreases blood pressure. 4-Biphenylac-Cys(Me)-D-Arg-Phe-(2-phenylethyl)amide has also shown to be an effective treatment for skin care products, especially those used for inflammatory skin diseases. 4-Biphenylac-Cys(Me)-D-Arg-Phe-(2-phenylethyl)amide has been shown to be a potent inhibitor of serine proteases and can inhibit cellular proliferation and induce apoptosis in cancer cells.</p>Formula:C41H49N7O4SPurity:Min. 95%Molecular weight:735.94 g/mol([D8]Val7·10)-C-Peptide (human)
CAS:Controlled Product<p>Please enquire for more information about ([D8]Val7·10)-C-Peptide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C129H195D16N35O48Purity:Min. 95%Molecular weight:3,036.35 g/molH-Arg-Gly-Tyr-Ala-Leu-Gly-OH
CAS:<p>H-Arg-Gly-Tyr-Ala-Leu-Gly-OH is a synthetic, competitive inhibitor of the aminopeptidase that cleaves the amino acid Arg from peptide chains. This compound has been shown to inhibit kinases in vitro and block viral replication in cell culture. H-Arg-Gly-Tyr-Ala-Leu-Gly-OH is reversibly inhibited by endogenous aminopeptidases, which have been shown to be involved in the regulation of cell proliferation and apoptosis.</p>Formula:C28H45N9O8Purity:Min. 95%Molecular weight:635.71 g/mol([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt
<p>Please enquire for more information about ([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-Gln-Ala-Arg-AMC·HCl
CAS:<p>Please enquire for more information about Boc-Gln-Ala-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H42N8O8·HClPurity:Min. 95%Molecular weight:667.15 g/mol6-Methoxy-2,3,4,9-tetrahydro-1H-β-carbolin-1-one
CAS:<p>6-Methoxy-2,3,4,9-tetrahydro-1H-beta-carbolin-1-one is a β-carboline alkaloid that is structurally related to harmaline and tetrahydroharmine. It has been shown to have antidepressant activity in animals. 6-Methoxy-2,3,4,9-tetrahydro-1H-beta-carbolin-1-one was analyzed by GC/MS and found to be present in the leaves of plants from the genus Tetraclinis. 6MHBC was also identified as a metabolite of diazepam in rat urine after administration of a single oral dose of 10 mg/kg diazepam. The observed β carboline metabolite was determined to be 6MHBC.</p>Formula:C12H12N2O2Purity:Min. 95%Molecular weight:216.24 g/molBoc-Glu-OFm
CAS:<p>Please enquire for more information about Boc-Glu-OFm including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H27NO6Purity:Min. 95%Molecular weight:425.47 g/molH-Gly-2-chlorotrityl resin (200-400 mesh)
CAS:<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Val-Tyr-Val-OH
CAS:<p>H-Val-Tyr-Val-OH is a water soluble polymer that has a sulfamic acid group and a hydroxyl group. The polymer film is used as an additive for cellulose acetate, which is used in the manufacture of films, lacquers, and adhesives. H-Val-Tyr-Val-OH increases the solubility of the cellulose acetate in hydrochloric acid and reduces its tendency to dissolve in water. H-Val-Tyr-Val-OH also has a high degree of uv absorption. Constant techniques are used for analytical chemistry, such as gas chromatography and nuclear magnetic resonance spectroscopy, to study the surface properties of micelles formed from H-Val-Tyr-Val-OH.</p>Formula:C19H29N3O5Purity:Min. 95%Molecular weight:379.45 g/molGlycinamide hydrochloride
CAS:<p>Glycinamide hydrochloride is an inhibitor that binds to the glycine-binding site of the protein synthetase and inhibits the formation of glycinamide ribonucleotide. It has been shown to inhibit human glycinamide ribonucleotide synthetase in vitro. Glycinamide hydrochloride is also a glycinamide amide, which was synthesized by linking two molecules of glycine with an amide bond. This molecule is cross-linked with a macrogel, forming a hydrogel. The hydrogel can be used in biomedical applications, such as tissue engineering and drug delivery systems.</p>Formula:C2H7ClN2OColor and Shape:White PowderMolecular weight:110.54 g/molH-Leu-bNA
CAS:<p>H-Leu-bNA is a gene product that has been activated and is involved in the production of chronic arthritis. H-Leu-bNA is a basic protein that catalyzes the conversion of chloromethyl ketone to iodoacetic acid, which then converts neutral ph substances to acidic ph substances. This enzyme also catalyzes the conversion of amino acids to their corresponding amines and ammonia. H-Leu-bNA may be involved in autoimmune diseases with acidic phs, such as rheumatoid arthritis. It has an optimum pH of 7.4 and will not work at higher or lower pHs. The sequences for this enzyme are found in plants, but it is not found in humans or animals.br><br>H-Leu-bNA can be used as a kinetic tool to measure enzyme activity. Kinetic data for this enzyme show that it has a high affinity for chloromethyl ketone and can be inhibited by certain chemicals,</p>Formula:C16H20N2OPurity:Min. 95%Molecular weight:256.34 g/molH-Hyp (Bzl)-OH·HCl
CAS:<p>Please enquire for more information about H-Hyp (Bzl)-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H15NO3·HClPurity:Min. 95%Molecular weight:257.71 g/molH-Leu-allyl ester·p-tosylate
CAS:<p>H-Leu-allyl ester·p-tosylate is an amide with immobilized amino groups. It is an optically active compound that can be cumulated and used for biomolecular chemistry. H-Leu-allyl ester·p-tosylate has been shown to inhibit the growth of fungi by inhibiting the synthesis of tenuazonic acid, a mycotoxin that is found in contaminated grains.</p>Formula:C9H17NO2C7H8O3SPurity:Min. 95%Molecular weight:343.44 g/molpTH (1-31) amide (human)
CAS:<p>pTH (1-31) amide is a polymer conjugate that is used to treat osteoporosis. It has been shown to be effective in reducing the risk of fracture and increasing bone mineral density in animals. The compound binds to the extracellular domain of the estrogen receptor, altering its conformation and preventing it from interacting with other proteins in the nucleus. pTH (1-31) amide has also been shown to reduce blood pressure in animals by inhibiting angiotensin-converting enzyme. Clinical data on this drug are limited, but it has been well tolerated so far.</p>Formula:C162H270N50O46S2Purity:Min. 95%Molecular weight:3,718.32 g/molN,N'-Methylenediacrylamide
CAS:<p>N,N'-Methylenediacrylamide is a water-soluble compound that has been used as a fluorescent probe for hydrogen bonding. It has been shown to have different phase transition temperatures in different solvents and can be used as an experimental model for studying the effects of temperature on the behavior of water molecules. N,N'-Methylenediacrylamide reacts with hydrochloric acid to form the fatty acid N,N'-methylenebis(3-chloroacrylic acid) under acidic conditions. This reaction is reversible, and the reverse process can be catalyzed by sodium citrate or human serum. When exposed to radiation or surface methodology, it emits light at a wavelength of 350 nm.</p>Formula:C7H10N2O2Purity:Min. 95%Color and Shape:White Clear LiquidMolecular weight:154.17 g/molSV40 Nuclear Transport Signal Peptide Analog
CAS:<p>Please enquire for more information about SV40 Nuclear Transport Signal Peptide Analog including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H104N20O15SPurity:Min. 95%Molecular weight:1,377.66 g/molSyntide 2 trifluoroacetate salt
CAS:<p>Syntide 2 is a diacylglycerol, which has been found to have a number of biochemical properties. It is an activator of protein kinase C and has been shown to be reactive in vitro assays. Syntide 2 has also been found to activate the light chain kinase in plant physiology. This compound has also been shown to promote neuronal death and may have a role in transcriptional regulation. Syntide 2 is used as a model system for studying the physiological function of α subunit-containing proteins.</p>Formula:C68H122N20O18Purity:Min. 95%Molecular weight:1,507.82 g/molH-Ile-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Ile-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Azilsartan medoxomil
CAS:<p>Azilsartan medoxomil is an antihypertensive drug, which is a prodrug of the angiotensin II receptor blocker azilsartan. It is synthesized through a chemical process involving the modification of the medoxomil ester, converting it into its active form upon absorption in the gastrointestinal tract. The primary mode of action of azilsartan medoxomil involves selective antagonism of the angiotensin II type 1 (AT1) receptor. By blocking the effects of angiotensin II—a potent vasoconstrictor—azilsartan medoxomil effectively reduces vascular resistance, leading to decreased blood pressure.</p>Formula:C30H24N4O8Purity:Min. 95%Color and Shape:White PowderMolecular weight:568.53 g/molNeuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C110H180N32O38Purity:Min. 95%Molecular weight:2,558.8 g/molH-Lys(acetimidoyl)-OH
CAS:<p>Lysine acetimidate is a reactive compound that can be activated by the addition of an acid. Lysine acetimidate is a potent activator of macrophages and other inflammatory cells. It has been used in experimental models to study bowel disease and repair mechanisms. In these models, lysine acetimidate has shown to have anti-inflammatory effects, which may be due to its ability to decrease the production of pro-inflammatory cytokines by immune cells. The metabolic disorder caused by lysine acetimidate is still being studied. Lysine acetimidate also has immunomodulatory effects, as it can inhibit the synthesis of epidermal growth factor (EGF) in lung cells and cause damage to alveolar type II cells in the lung.</p>Formula:C8H17N3O2Purity:Min. 95%Molecular weight:187.24 g/molZ-Ile-Trp-OH
CAS:<p>Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H29N3O5Purity:Min. 95%Molecular weight:451.51 g/molH-Thr-Arg-OH sulfate salt
CAS:<p>H-Thr-Arg-OH sulfate salt is a molecule that contains the active amino acid residues of vasoactive intestinal peptide (VIP) and reversed-phase high-performance liquid chromatography. The structure of VIP was determined by stepwise synthesis and chloromethyl ketone activation. It has been shown to have an intestinal effect, which is due to its ability to increase blood pressure. This drug also has potential as a therapeutic agent in the treatment of hypertension, heart disease, or diabetes mellitus.</p>Formula:C10H21N5O4Purity:Min. 95%Molecular weight:275.31 g/molFluorescein-6-carbonyl-Tyr-Val-Ala-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Tyr-Val-Ala-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H50FN5O15Purity:Min. 95%Molecular weight:919.9 g/molH-Phe-β-Ala-OH
CAS:<p>H-Phe-beta-Ala-OH is a dipeptide analog of dermorphin. It has been shown to be an antinociceptive agent in the tail-flick test, and also inhibits the effects of naloxone, an opioid antagonist. H-Phe-beta-Ala-OH may be an effective analgesic that could be used as a substitute for morphine.</p>Formula:C12H16N2O3Purity:Min. 95%Molecular weight:236.27 g/mol(β-Ala8)-Neurokinin A (4-10)
CAS:<p>Please enquire for more information about (Beta-Ala8)-Neurokinin A (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H56N8O10SPurity:Min. 95%Molecular weight:780.93 g/molH-Leu-Ser-Ala-Leu-OH
CAS:<p>H-Leu-Ser-Ala-Leu-OH is a chemical compound that has been shown to bind to 5-HT1B receptors. This receptor belongs to the 5HT1 family of serotonin receptors, which are G protein coupled receptors. The 5HT1B receptor has been shown to have a role in locomotor activity and dopamine release. HLSALLOH is also a specific antibody that reacts with the 5HT1B receptor in rats. The location of this receptor is on the dorsal raphe nucleus and other parts of the brainstem. HLSALLOH has a pH optimum of 6.0 and can be used as an immunogen for polyclonal antibodies against 5HT1B receptors.</p>Formula:C18H34N4O6Purity:Min. 95%Molecular weight:402.49 g/mol

