Amino Acids (AA)

<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>

<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide is a pharmacological agent that inhibits the toll-like receptor 4 signaling pathway. L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide has been shown to cause caspase independent cell death by inducing cathepsin and iron homeostasis. The drug also causes polymerase chain reaction inhibition and neuronal death in vivo.</p>

<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-Angiotensin I Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Pro-Leu-Gly-NHOH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Tyr-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Trp(Boc)-Thr(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Ile-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Angiotensin (1-12) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Tyr-L-1,2,3,4-tetrahydroisoquinoline-3-carboxamide·HCl is a monoclinic crystalline compound. It has a molecular weight of 607.14 and contains the dipeptide Tyr-Lys in its structure. H-Tyr-L-1,2,3,4-tetrahydroisoquinoline-3-carboxamide·HCl crystallizes in the P21/c space group and has an asymmetric unit cell with dimensions a=8.851 Å, b=7.965 Å and c=5.98 Å. This compound has been shown to have antibacterial properties against methicillin resistant Staphylococcus aureus (MRSA) isolates and Clostridium perfringens strains by inhibiting bacterial protein synthesis through inhibition of peptidyl transferase activity.</p>

<p>Please enquire for more information about Boc-D-His(3-Bom)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Nle 8·21,Tyr34)-pTH (1-34) amide (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-(Chloromethyl)-5-methylpyridine hydrochloride (3CMPH) is a chemical compound that is synthesized from chlorine and methylpyridine. 3CMPH can be produced by the reaction of chlorination with toluene or hydrogen chloride. The synthesis of 3CMPH is done in two steps: first, reacting toluene with chlorine gas at high temperature and pressure in the presence of sulfuric acid, followed by the addition of sulfuric acid to the resulting product. In the second step, hydrogen chloride reacts with methylpyridine in an alkaline solution, yielding 3-(chloromethyl)-5-methylpyridine hydrochloride as a white solid. 3CMPH has been shown to have antihistamine effects and can be used for treating allergies. It can also be used as a skin protectant against uv light and rupatadine.</p>

<p>Senktide is a substance P analog that has been shown to produce tail-flick responses in animals. The maximum response of the tail-flick test can be enhanced by the administration of either dopamine or serotonin. Inhibition of metabolism is likely to be responsible for these effects, as demonstrated by experiments in Sprague-Dawley rats. Senktide is an experimental model for studying the role of substance P in the regulation of blood pressure and locomotor activity. This compound also has pressor properties that are similar to those of dopamine and serotonin, which may be due to its ability to stimulate alpha-adrenergic receptors and inhibit dopaminergic neurons via a presynaptic mechanism.</p>

<p>Galanin is a peptide that is part of the galaninergic system. It is involved in the regulation of insulin resistance, pain sensation, and chronic bronchitis. Galanin has been found to inhibit ATP-sensitive K+ channels and to have an inhibitory effect on ryanodine receptors. This inhibition leads to an increase in cytosolic Ca2+. Galanin also inhibits the release of inflammatory cytokines such as IL-1β, IL-6, and TNF-α. The biological properties of galanin are not fully understood and it may be associated with cancer and autoimmune diseases.</p>

<p>Methylenedi-p-phenyl diisocyanate (MDI) is a glycol ether, which is a potent inducer of allergic reactions. It can be found in polyurethane foam insulation and in the production of diphenyl and diisocyanate. MDI has been shown to cause asthma, skin inflammation, and other respiratory problems. MDI is highly toxic to aquatic life and can cause long term effects on fish populations. The toxicity of MDI depends on the concentration and duration of exposure, as well as the species that it is administered to. High concentration exposure for a short period of time will result in death by respiratory failure or cardiac arrest. Longer exposure at lower concentrations may lead to liver, kidney, lung damage or cancerous tumor development.</p>

<p>Peptide WE-14 H-Trp-Ser-Lys-Met-Asp-Gln-Leu-Ala-Lys-Glu-Leu-Thr-Ala-Glu is a tetradecapeptide that is a candidate for the diagnosis of pancreatic cancer. It has been shown to localize to the pancreas and other tissues in immunohistochemical studies. This peptide was found to be present in chromaffin cells and ileal tissue, which are associated with pancreatic cancer. Peptide WE14 H Trp Ser Lys Met Asp Gln Leu Ala Lys Glu Leu Thr Ala Glu also binds to markers expressed at high levels in pancreatic cancers such as insulinoma, endocrine tumor, and neuroendocrine tumor.</p>

<p>Fmoc-Asp-OAll is a cyclic peptide that has been shown to be active against human cancer cell lines in vitro. Fmoc-Asp-OAll binds to integrin receptors, inhibiting the prostaglandin synthesis pathway and thus reducing inflammation. It also inhibits the activity of enzymes that are involved in inflammatory responses. Fmoc-Asp-OAll is synthesized on solid phase by chemical ligation.</p>

<p>Des-Tyr1-Met-Enkephalin H-Gly-Gly-Phe-Met-OH is a peptide that is derived from the endorphin family. It has been shown to have both amnestic and enkephalin effects, which may be due to its antagonistic effect on naloxone. This endogenous peptide has been studied in a dose response curve, with an increase in amnesia and decrease in memory retention as the dose increases. Des-Tyr1-Met-Enkephalin H-Gly-Gly-Phe-Met-OH also binds to receptors at the same sites as other substances such as epinephrine, β endorphin, and behavioral effects are observed.</p>

<p>Z-Leu-Gly-OH is a peptide inhibitor of serine proteases. This peptide is a potential inhibitor of trypanosome proteinases, which are enzymes that cleave proteins into smaller pieces. Z-Leu-Gly-OH is a reversible inhibitor of mammalian proteinase and nitrile protease with a high affinity for the target enzyme.</p>

<p>3-(Boc-amino)pyridine is a glycine derivative with a trigonal, chelate ring. It can be hydrolyzed by acid to form 3-aminopyridine. 3-(Boc-amino)pyridine has been shown to react with trimethyltin chloride to form an intramolecular complex in the presence of alkyllithiums. This reaction proceeds through lithiation and methylation of the carboxyl group of 3-(Boc-amino)pyridine. The interaction between 3-(Boc-amino)pyridine and trimethyltin chloride forms an antiaromatic six membered ring that resembles a benzene molecule.</p>

<p>Please enquire for more information about Boc-Pen (NPys)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Phe-OBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu(Glu(Gln-OH)-OH)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about D-(-)-2-Chlorophenylglycine methyl ester hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin I is a peptide that belongs to the class of substances called angiotensins. This substance is found in many tissues and organs, including the brain, adrenal gland, and lung. Angiotensin I has been shown to be a pressor agent and also has biochemical effects on amino acid composition. The c-terminal sequence of this substance has been determined by incubating the molecule with pepsin at different pH values. The molecular weight of this substance is 938 Da and it has an amino acid composition of Asp-Arg-Val-Tyr-Val-His-Pro-Phe-His-Leu.</p>

<p>Please enquire for more information about H-Arg-Phe-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Pro-Met-OH is a potent inhibitor of protein kinases. It has been shown to be resistant to peptidyl and sulphonium activation and also inhibits trypsin and other proteases. Z-Pro-Met-OH is a chloromethane derivative that is both an inhibitor of protein kinases and a substrate for the enzyme, which generates a constant concentration of product in the presence of enzyme. Z-Pro-Met-OH is more sensitive than other inhibitors tested to date, with the exception of staurosporine. It has sequence similarity to mammalian proteins, but lacks homology with any known protein.</p>

<p>Please enquire for more information about Fmoc-a-Me-D-Asp(OtBu)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hippocampal Cholinergic Neurostimulating Peptide Ac-Ala-Ala-Asp-Ile-Ser-Gln-Trp-Ala-Gly-Pro-Leu is a peptide hormone that has been found in the hippocampus. It is a cholinergic neurotransmitter that is synthesized and secreted by neurons in the brain. It has been shown to have an effect on bowel disease, locomotor activity, and hippocampal formation. Hippocampal Cholinergic Neurostimulating Peptide Ac-Ala-Ala-Asp-Ile-Ser-Gln-Trp was first identified through biochemical analysis of rat brain tissue.</p>

<p>P-hydroxyhippuryl-His-Leu-OH is a natriuretic that has been shown to have beneficial effects on diabetic patients. It can be used to prevent and treat proliferative diabetic retinopathy, which is a complication of diabetes. P-hydroxyhippuryl-His-Leu-OH increases the glomerular filtration rate and decreases the ventricular mass index, which may be due to its ability to inhibit angiotensin II receptors in the brain. P-hydroxyhippuryl-His-Leu-OH also inhibits angiotensin converting enzyme, an enzyme that converts angiotensin I into angiotensin II. This inhibition leads to an increase in levels of atrial natriuretic peptide (ANP), brain natriuretic peptide (BNP), and the downstream effectors of these peptides, namely nitric oxide synthase and cyclooxygenase</p>

<p>H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt is a peptide that has been shown to inhibit the growth of tumor cells. It has also been shown to have biological properties in a number of experimental models, including in vitro and in vivo studies. H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt inhibits muscle cell proliferation by binding to the extracellular matrix protein collagen type I. This inhibition leads to reduced tissue formation and body growth. This peptide also inhibits the proliferation of cancer cells by blocking the production of growth factor beta 1 (GFβ1).</p>

<p>N-alpha-Trityl-Nepsilon-Fmoc-L-lysine is a pentapeptide that is used in peptides. It has been shown to have cytotoxicity and permeability, as well as being biologically active. N-alpha-Trityl-Nepsilon-Fmoc-L-lysine has also been used in solid phase synthesis of peptides. This pentapeptide can be synthesized using the Miyaura cross coupling reaction with an ether or Suzuki cross coupling reaction. N-alpha-Trityl-Nepsilon-Fmoc-L-lysine is a bicyclic molecule that can be synthesized on a solid phase.</p>

<p>Please enquire for more information about Acetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Pro-Phe-OH is a synthetic peptide that is used in the treatment of high blood pressure. It has been shown to decrease blood pressure by increasing the production of nitric oxide and by decreasing activity of angiotensin converting enzyme, which are factors that have an influence on blood pressure. H-Pro-Phe-OH has been shown to be effective for treating HIV infection and amyloidosis. H-Pro-Phe-OH binds to collagen and increases its production in tissues, which may be responsible for its antihypertensive effects. It also inhibits the growth of bacteria by binding to their cell walls and inhibiting their protein synthesis. The metabolic products of H-Pro-Phe-OH are not yet known, but it is thought that they may contain hydroxyproline or hydroxylysine residues.</p>

<p>H-Pro-Ser-Hyp-Gly-Asp-Trp-OH is a cyclic hexapeptide with a high activity against platelets. It is an antagonist of the cyclic RGD sequence, which is present in fibrinogen, fibronectin, vitronectin and other proteins. This peptide binds to the n-terminal residue of these proteins and prevents them from binding to their receptors on the surface of platelets. H-Pro-Ser-Hyp-Gly-Asp-Trp-OH has been shown to be specific for human platelets and does not bind to erythrocytes or leukocytes.</p>

<p>H-His-Phe-OH is a polypeptide that is used in the diagnosis of chronic kidney disease. It is synthesized by the chemical reaction between histidine and phenylalanine. H-His-Phe-OH has been shown to have a molecular weight of 4,000 Da, with a diameter of 5 nm. The binding constants for this molecule are 3.5 x 10^6 M^(-1), and its stability in biological fluids has been shown to be greater than 100 hours at pH 7.4, 37°C.</p>

<p>Please enquire for more information about [(RS)-2-Carboxy-3-phenylpropionyl]-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (1-6) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Phe-Pro-bNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neurotensin (NT) is a neuropeptide that is derived from the prepro-NT gene. It binds to the neurotensin receptor 1 (NTSR1) and has been shown to regulate intestinal motility, as well as function as an adjuvant therapy for enteric diseases. Neurotensin has been shown to be neuroprotective against dopamine toxicity in cell cultures, and could be used in cancer therapy. The profile of neurotensin has been studied in clinical trials for metastatic breast cancer and other cancers. Neurotensin does not have any significant safety issues, although it can cause neuronal death when administered intracerebroventricularly.</p>

<p>Boc-Tyr(tBu)-OH is a chemical compound that is part of the class of lactams. It has been shown to have antitumor activity in vitro and in vivo, but it has not yet been tested for its cytotoxicity. This compound is synthesized by solid-phase synthesis and contains a disulfide bond, which may contribute to its cytotoxicity. Boc-Tyr(tBu)-OH has also been shown to have high affinity for the alpha 2A adrenergic receptor subtype and other receptors with an isosteric carbonyl group.</p>

<p>Please enquire for more information about Calcium-Like Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-muramyl-Ala-D-Glu(Lys(stearoyl)-OH)-NH2 is a synthetic peptide that was designed to mimic the sequence of muramyl dipeptide (MDP), which is found in bacterial cell walls. Ac-muramyl-Ala-D-Glu(Lys(stearoyl)-OH)-NH2 binds to the protein albumin, which is an important component of human blood plasma and has been shown to be elevated in patients with autoimmune diseases. This peptide also inhibits the activity of metal hydroxides, such as aluminum hydroxide and calcium hydroxide, by binding to their surface, reducing their antimicrobial activity. The effect on locomotor activity has not been studied. Ac-muramyl-Ala-D-Glu(Lys(stearoyl)-OH)-NH2 may have effects on various cells types including macrophages and T</p>

<p>Abz-Ser-Pro-3-nitro-Tyr-OH is a chromophobe peptide that is expressed in renal cell carcinomas. It is a potent inhibitor of all three major classes of proteases: serine, cysteine and aspartyl proteases. Abz-Ser-Pro-3-nitro-Tyr-OH inhibits the activity of peptidases, which are enzymes involved in protein degradation and turnover. Abz has been shown to inhibit the activity of intrarenal proteolytic enzymes, including endopeptidase, metallopeptidase and aminopeptidase activities. Abz also has been shown to inhibit the expression of markers on the surface of kidney cells and to reduce renal cell proliferation.</p>

<p>Please enquire for more information about Fibronectin Fragment (1377-1388) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-Ethyl-3-methylimidazolium ethyl sulfate is a surfactant that has a high thermal expansion coefficient. It can be used as a solvent to dissolve ionic substances and can be used in experiments involving hydrogen fluoride, ionic liquids, and reaction mechanisms. 1-Ethyl-3-methylimidazolium ethyl sulfate is not toxic to cells and animals in the short term, but the long term effects of this compound are unknown. The heat capacity of this substance is high and it has been shown to emit light when exposed to xrays. This compound also shows hydrogen bonding interactions with other ions in solution.</p>

<p>Please enquire for more information about H-Ala-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-L-methionine is a chemical compound that contains the amino acid methionine. It is used in solid-phase synthesis to produce cyclic peptides and proteins. Boc-L-methionine is activated by treatment with trifluoroacetic acid and then reacts with a protected amino acid to form the corresponding amide or ester, respectively. The activated carboxylic acid group of Boc-L-methionine reacts with an unprotected amino group of the amino acid to form an amide or ester linkage, respectively. The reaction products are cleaved from the resin support by hydrogen fluoride for purification.</p>

<p>Please enquire for more information about IGF-I (24-41) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-N-Me-D-Tyr-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Tyr-Gly-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N,S-Bis-Fmoc-glutathione Fmoc-Glu(Cys(Fmoc)-Gly-OH)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Glu-Phe-Tyr-OH is a peptide transporter that is located on the apical surface of intestinal cells. It is a monovalent cation/H+ symporter that transports H+ and peptides in an electroneutral manner. The uptake rate of this peptide transporter is influenced by the concentration gradient of the substrate, with higher concentrations increasing the uptake rate. It has been shown to transport lidocaine, which suggests it may be used to treat patients who are resistant to other drugs. H-Glu-Phe-Tyr-OH also has a high affinity for peptides, making it possible to use this drug as a means of delivering therapeutic proteins orally.</p>

<p>Please enquire for more information about H-Leu-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Substance P is a tachykinin that is released from the nerve endings of the parasympathetic nervous system. It binds to receptors in the plasma membrane of cells and causes them to release acetylcholine, which is an inhibitory neurotransmitter. Substance P also has been shown to interact with muscle cells and cause contractions. The incubation of Substance P with muscle cells inhibits the release of calcium ions, which reduces the membrane potential and decreases the contractility of these cells.</p>

<p>Angiotensin II is a peptide hormone. It is a potent vasoconstrictor that also stimulates the release of aldosterone from the adrenal gland, leading to an increase in blood pressure. Angiotensin II can be produced either by proteolytic cleavage of angiotensinogen (a zymogen) or by post-translational modification of angiotensin I (a decapeptide). Angiotensin II is a potent agonist of the thrombin receptor and binds to one of four subtypes of angiotensin receptors (AT1). The AT1 receptor antagonist is a drug that blocks the biological activity of angiotensin II and has been used clinically for treatment of hypertension.</p>

<p>Please enquire for more information about Platelet Factor 4 (58-70) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Trp6)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Trp-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Ile-Glu-Pro-Asp-pNA is a synthetic peptide that has been shown to induce apoptosis in tumor cells. The peptide was found to cause cell lysis and necrotic cell death, which is associated with the activation of serine proteases. Ac-Ile-Glu-Pro-Asp-pNA also has been shown to have a toxicity profile similar to other apoptotic agents such as staurosporine, but it has not been tested for its ability to kill cancer cells without causing damage to healthy cells. Ac-Ile-Glu-Pro-Asp-pNA induces mitochondrial membrane depolarization and protein synthesis inhibition in K562 cells, which are human erythroleukemia cells. This peptide also has shown an ability to bind with monoclonal antibodies and inhibit the growth of casein.</p>

<p>Please enquire for more information about (Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Met-OH acetate salt is a reactive chemical that is used in the treatment of hepatitis. It has been shown to be effective against virus and heart disease, as well as being active in the prevention of insulin resistance. H-Arg-Met-OH acetate salt is also used to determine if a person has had an allergic reaction by testing for elevated serum levels of this chemical. H-Arg-Met-OH acetate salt can be found in the blood, urine, and liver cells. This chemical is also present in mouse spleen cells and has been shown to react with specific antibodies.</p>

<p>Mitogenic Pentapeptide Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Ser-Asn-Ala-OH is a synthetic pentapeptide that can be used to induce cell proliferation and antibody production. This peptide has been used in clinical trials with regulatory approval for use in humans. It has been shown to promote antibody response in animal experiments and to be active against tumor cells in tissue culture and cell cultures. Mitogenic Pentapeptide Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Ser-Asn-Ala-OH also activated the monoclonal antibodies produced by hybridoma cells.</p>

<p>Please enquire for more information about Fmoc-Val-Ser(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Lys-Pro-OH hydrochloride salt is a monoclonal antibody that is used to treat psychotic disorders. It blocks the binding of gamma-aminobutyric acid (GABA) to its receptor, which reduces neuronal activity and has a calming effect on the central nervous system. H-Lys-Pro-OH hydrochloride salt also inhibits the phosphatase enzyme and prevents it from breaking down phosphotungstic acid, which is used in this process. The antibody also binds to the analog of gamma aminobutyric acid, preventing it from binding with its receptor. H-Lys-Pro-OH hydrochloride salt may be advantageous in treating kidney fibrosis because it prevents cell proliferation and growth in tissue cultures by inhibiting enzymes involved in collagen synthesis. H-Lys-Pro-OH hydrochloride salt may also be useful as an antitumor agent because it inhibits tumor growth by blocking uptake and replication of DNA.</p>

<p>Please enquire for more information about H-D-Glu(pNA)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Leu-Ser-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Val-Arg-Lys-Arg-Thr-Leu-Arg-Arg-Leu (HVLAHR) is a synthetic peptide that has been shown to have antiinflammatory properties. The peptide binds to the epidermal growth factor receptor (EGFR) and inhibits the production of proinflammatory cytokines and chemokines, such as IL1α, IL6, IL8, and TNFα. HVLAHR also binds to calmodulin and inhibits protein kinase C (PKC) activity. It has been shown that this peptide has neuroprotective effects in vitro by binding to neurogranin and inhibiting protein phosphorylation. HVLAHR can be used as a model organism in vitro to study protein kinase activity.</p>

<p>Z-D-Phe-Phe-Gly-OH is a lysosomal carboxypeptidase that hydrolyzes peptides at the C terminus of proteins. It has a wide substrate specificity and can hydrolyze Z-D-Phe-Phe-Gly, Z-Arg-Lys, and L-Arg. This enzyme has been shown to have ion exchange chromatography activity. The elution profile for this enzyme on a sephadex G-100 column was found to have an optimum pH of 7.5 and elutes at a salt concentration of 0.5M NaCl. Carboxypeptidases are enzymes that cleave at the C terminus of proteins to produce smaller peptides or amino acids. They are involved in digestion, blood clotting, and cell signaling processes.</p>

<p>Please enquire for more information about Fmoc-Ile-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FA-Gly-Phe-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Ser1)-Cerebellin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about DNA Transcription Inhibitory Peptide Pyr-Asp-Asp-Ser(PO3H2)-Asp-Glu-Glu-Asn-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Enterotoxin STp (E. coli) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Procathepsin B (26-50) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Pro-Gly-OH is a synthetic tetrapeptide that is used as a substrate molecule to study collagen hydroxylases. It has been shown to be an excellent substrate for the enzyme collagenase, and its chemical data indicates that it is bound by metal ions. The technique of dichroism was used to confirm the secondary structure of Boc-Pro-Gly-OH. This tetrapeptide has four amino acids, which are proline, glycine, histidine, and hydroxyproline.</p>

<p>Please enquire for more information about N-2-Hydroxyethyl-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Phe-OBzl is an opioid drug that has been used as a research tool for studying the effects of opioid drugs on the nervous system. Z-Phe-OBzl is a synthetic peptide with a high affinity for opioid receptors. It has been shown to be a potent natural product antagonist and endogenous agonist, which may be useful in the treatment of pain. The oral bioavailability of Z-Phe-OBzl has also been reported to be greater than 90%.</p>

<p>Boc-Met-Gly-OH is an ester that can be synthesized by the reaction of Boc-glycine and methanol in aqueous sodium hydroxide. The product is soluble in organic solvents, such as dichloromethane, chloroform, and diethyl ether. Monitoring of this reaction yields the acid residues. The ester also has hydrophilic properties due to its amino group and methylene side chain. This compound can be used as a catalyst for reactions involving chloride or hydrophobic amino groups. It is not active for reactions with hydrophilic amino acids or immobilized catalysts.</p>

<p>Please enquire for more information about (Arg8)-Vasopressin (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Sar 1,Ile4·8)-Angiotensin II trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tyrosine is a non-essential amino acid that is an important component of proteins. It can also be synthesized in the body from the essential amino acid phenylalanine. Tyrosine is found in many foods and is made by plants, bacteria, and animals. The most common form of tyrosine in food is L-tyrosine. H-Tyr-Glu-Trp-OH is a neurotrophic factor that interacts with tyrosine kinase receptors to promote neuron survival and function. H-Tyr-Glu-Trp-OH has been shown to have neuroprotective effects in neonatal rats, preventing neuronal death due to genetic ablation or biochemical inhibition of neurotransmitter release.<br>Synaptic transmission refers to the propagation of nerve impulses across synapses, which are gaps between neurons. Neurotrophic factors are proteins produced by neurons that regulate the growth and maintenance of neurons.END&gt; END&gt;</p>

<p>Ac-Met-AMC is a nucleoside analog that is an active inhibitor of the enzyme DNA polymerase. This drug has been shown to be effective in preventing the growth of cancer cells in tissue cultures, and it has also been used to study the relationship between isoforms and oxygenated species. Ac-Met-AMC binds to the cytosolic side of the enzyme, which reduces its activity, but this binding does not affect the enzyme's ability to bind substrate or ATP. Ac-Met-AMC has been shown to hydrolyze with a rate constant of 6 x 10 M(-1) s(-1).</p>

<p>Please enquire for more information about H-Pro-Val-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about DABCYL-(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (661-675)-EDANS ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Leu31,Pro34)-Neuropeptide Y (13-36) (human, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cyclo(-D-His-Pro) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>