
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,469 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38260 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Galanin Message Associated Peptide (44-59) amide
CAS:<p>Please enquire for more information about Galanin Message Associated Peptide (44-59) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H100N18O25Purity:Min. 95%Molecular weight:1,485.55 g/molIDR-1 trifluoroacetate salt
CAS:<p>IDR-1 is a peptide that is derived from the sequence of the human typhimurium protein. IDR-1 has been shown to have anti-inflammatory properties and modulates immune responses in mice. In particular, IDR-1 inhibits neutrophil chemotaxis by inhibiting formyl peptide receptor signaling. This peptide also inhibits bacterial chemokines, which are important for the recruitment of neutrophils. IDR-1 also has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and pertussis.</p>Formula:C65H118N18O15Purity:Min. 95%Molecular weight:1,391.74 g/molH-Nle-Arg-Phe-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Nle-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N7O3Purity:Min. 95%Molecular weight:433.55 g/molH-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-OH
CAS:<p>Please enquire for more information about H-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H91N17O15Purity:Min. 95%Molecular weight:1,254.44 g/molAc-Leu-Glu-Val-Asp-AFC
CAS:<p>Please enquire for more information about Ac-Leu-Glu-Val-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H40F3N5O11Purity:Min. 95%Molecular weight:727.68 g/molZ-Phe-Leu-OH
CAS:<p>Z-Phe-Leu-OH is a protease inhibitor that belongs to the group of peptidyl-protease inhibitors. It inhibits the activity of a wide range of proteases and is specifically active against carboxypeptidases A and B. Z-Phe-Leu-OH has been shown to be specific for these enzymes, with no inhibitory activity against other proteases such as aminopeptidases, serine proteases, or metalloproteases. The amino acid composition of this protease inhibitor is different from other inhibitors that have been studied in detail. This agent was found to be more effective than phenylmethylsulfonyl fluoride (PMSF) at inhibiting carboxypeptidase A and B.<br>Z-Phe-Leu-OH has been shown to be an acidic compound with a pKa of 5.5; however, it does not react with chloromethyl ketone</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/molAntistasin-Related Peptide
CAS:<p>Please enquire for more information about Antistasin-Related Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H57N15O8S2Purity:Min. 95%Molecular weight:868.04 g/molBoc-guanidine
CAS:<p>Guanidine is a guanidinium cation that is used in the treatment of autoimmune diseases, cancer, and aspartyl receptor activity. Boc-guanidine is an efficient method for the synthesis of guanidine. It has been shown to be effective in treating inflammatory diseases and neutral pH conditions. Boc-guanidine inhibits glycogen synthase kinase-3 (GSK3) and membrane interactions, which are associated with a number of human disorders. It also has antimicrobial properties against marine microorganisms.</p>Formula:C6H13N3O2Purity:Min. 95%Molecular weight:159.19 g/molH-β-Cyclohexyl-Ala-OMe·HCl
CAS:<p>Please enquire for more information about H-beta-Cyclohexyl-Ala-OMe·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19NO2·HClPurity:Min. 95%Molecular weight:221.72 g/molCholecystokinin-33 (10-20) (bovine, porcine)
CAS:<p>Please enquire for more information about Cholecystokinin-33 (10-20) (bovine, porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H90N16O18Purity:Min. 95%Molecular weight:1,251.39 g/molHippuryl-Lys-Val-OH
CAS:<p>Hippuryl-Lys-Val-OH is a metal chelator that binds to the positively charged amino acid lysine. It has been shown to be effective in inactivating enzymes and inhibiting the growth of bacteria, such as frondosa, by binding to the enzyme metalloendopeptidase. The optimum pH for this compound is between 7 and 8. Hippuryl-Lys-Val-OH has also been shown to have a strong affinity for hippuric acid, which can be utilized as a measure of its concentration.</p>Formula:C20H30N4O5Purity:Min. 95%Molecular weight:406.48 g/molNFAT Inhibitor trifluoroacetate salt
CAS:<p>NFAT Inhibitor trifluoroacetate salt H-Met-Ala-Gly-Pro-His-Pro-Val-Ile-Val-Ile-Thr-Gly-Pro-His-Glu-Glu (NFAT) is an inhibitor drug that has been shown to inhibit the nuclear factor of activated T cells (NFAT). NFAT is a transcriptional regulator that controls the expression of inflammatory genes in macrophages and other cell types. NFAT inhibitors have been shown to be effective for treating bowel diseases, such as ulcerative colitis and Crohn's disease, by inhibiting the activation of macrophages. NFAT inhibitors are also used in vitro as a tool for studying cellular signaling pathways. The most common type of NFAT inhibitor is fluconazole, which blocks calcineurin activity and prevents the activation of NFAT. However, other types of inhibitors are being developed, including mmp9 activity or</p>Formula:C75H118N20O22SPurity:Min. 95%Molecular weight:1,683.93 g/molH-Val-Phe-OH
CAS:<p>H-Val-Phe-OH is a peptide consisting of three amino acids, Valine, Phenylalanine and Hydroxyproline. It is a small molecule that has been shown to have an antihypertensive effect in rats. H-Val-Phe-OH binds to the dihydropyridine receptor on the cell membrane surface, which causes blood vessels to relax and contract. This action leads to decreased blood pressure. The high reactivity of H-Val-Phe-OH with other molecules makes it biodegradable, which means it can be broken down by water or enzymes into smaller molecules that are less harmful to the environment.</p>Formula:C14H20N2O3Purity:Min. 95%Molecular weight:264.32 g/molAcetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H85FN16O13Purity:Min. 95%Molecular weight:1,365.51 g/molH-Phe-Ser-OH
CAS:<p>H-Phe-Ser-OH is a molecule that is present in the bacterial strain. It can be used in diagnosis, where it can be detected by messenger RNA profiling and kinetic analysis of uptake. In vitro synthesis of H-Phe-Ser-OH was performed using caco-2 cells and metabolic profiles were obtained from this experiment. Hydroxyl groups are found on the molecule, which are important for diagnostic purposes. This molecule has been shown to form hydrogen bonds with other molecules, which may also be useful for diagnostic tests.</p>Formula:C12H16N2O4Purity:Min. 95%Molecular weight:252.27 g/molAbz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Gly-Ala-Ala-Pro-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H49N9O14Purity:Min. 95%Molecular weight:903.89 g/molCaerulein (desulfated)
CAS:<p>Caerulein (desulfated) Pyr-Gln-Asp-Tyr-Thr-Gly-Trp-Met-Asp-Phe-NH2 is a decapeptide that is found in the Australian frog, Caerulea. It has been shown to be a potent extractant of ionic materials and can be used in the separation of proteins by ion exchange chromatography. The sequence is as follows: Caerulein (desulfated) Pyr-Gln-Asp-Tyr-Thr-Gly-Trp-Met-Asp-Phe. It has an acid composition of Cys, Asp, Tyr, Glu, Pro, Gly, Phe and Met. The amino acid composition is Pro, Ala, Gly, Val, Gln and Leu. Caerulein (desulfated) Pyr-Gln has been shown to have antihypertensive effects due to</p>Formula:C58H73N13O18SPurity:Min. 95%Molecular weight:1,272.34 g/molFmoc-Thr(PO3H2)-OH
CAS:<p>Please enquire for more information about Fmoc-Thr(PO3H2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H20NO8PPurity:Min. 95%Molecular weight:421.34 g/molHydrin 2
CAS:<p>Hydrin 2 is a member of the family of peptide hormones that are involved in the regulation of blood pressure. It is synthesized from two amino acids, H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Arg-Gly-Gly-. Hydrin 2 has been shown to have biological properties that are similar to those of angiotensin II and vasopressin. This peptide hormone is produced as a result of the action of hydrochloric acid on the precursor peptide, which is synthesized in the ventral and apical regions of the bladder. The reaction product is soluble in water and has been shown to be effective at treating wastewater.</p>Formula:C45H69N15O14S2Purity:Min. 95%Molecular weight:1,108.25 g/molH-Pro-Phe-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Pro-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H33N5O5Purity:Min. 95%Molecular weight:447.53 g/molZ-β-Ala-Val-OH
CAS:<p>Please enquire for more information about Z-beta-Ala-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H22N2O5Purity:Min. 95%Molecular weight:322.36 g/mol(H-Cys-Ala-OH)2 (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-Ala-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H22N4O6S2Purity:Min. 95%Molecular weight:382.46 g/molZ-Arg-Arg-bNA acetate salt
CAS:<p>Please enquire for more information about Z-Arg-Arg-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H39N9O4Purity:Min. 95%Molecular weight:589.69 g/molBoc-Glu(Lys-OH)-OH
CAS:<p>Please enquire for more information about Boc-Glu(Lys-OH)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H29N3O7Purity:Min. 95%Molecular weight:375.42 g/molFA-Ala-Arg-OH
CAS:<p>F-Ala-Arg-OH is a peptide hormone that has been shown to have antitumor, antiinflammatory, and antidiabetic properties. The peptide hormone binds to the creatine kinase enzyme and inhibits its activity, which leads to a decrease in phosphocreatine levels in the human serum. F-Ala-Arg-OH does not inhibit lysine residues of the creatine kinase enzyme. This inhibition can be reversed by adding ATP or adding an activator. F-Ala-Arg-OH also inhibits cancer cells through apoptosis. This inhibition of cancer cells may be due to the ability of this peptide to bind to lysine residues on cell membranes and activate them. F-Ala-Arg-OH is also able to destroy tumor cells by binding to their mitochondria and inducing their lysis.</p>Formula:C16H23N5O5Purity:Min. 95%Molecular weight:365.38 g/mol1,2-Distearoyl-sn-glycero-3-phosphatidic acid·disodium salt
CAS:<p>Please enquire for more information about 1,2-Distearoyl-sn-glycero-3-phosphatidic acid·disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H75Na2O8PPurity:Min. 95%Molecular weight:748.96 g/molA-VI-5 acetate salt
CAS:<p>Please enquire for more information about A-VI-5 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H40N6O10Purity:Min. 95%Molecular weight:548.59 g/mol(Tyr0)-Neurokinin A
CAS:<p>Please enquire for more information about (Tyr0)-Neurokinin A including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H89N15O16SPurity:Min. 95%Molecular weight:1,296.5 g/molH-Tyr-Val-OH
CAS:<p>H-Tyr-Val-OH is a model system for the study of monoclonal antibodies that are unable to bind to antigen. It has been shown to inhibit the production of signal protein, which is involved in cell proliferation and differentiation. H-Tyr-Val-OH also inhibits cell factor, which is a key component in the immune system. H-Tyr-Val-OH has been used as an oxidation catalyst to destroy the human immunodeficiency virus (HIV). The drug binds to human macrophages and blocks the activity of ATP binding cassette transporter. This leads to inhibition of HIV infection by preventing HIV from entering cells, thus inhibiting its replication.</p>Formula:C14H20N2O4Purity:Min. 95%Molecular weight:280.32 g/mol(Des-Gly10,D-Trp6,Pro-NHEt 9)-LHRH (sea bream)
CAS:<p>Please enquire for more information about (Des-Gly10,D-Trp6,Pro-NHEt 9)-LHRH (sea bream) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H76N14O13Purity:Min. 95%Molecular weight:1,213.34 g/molAc-Ala-Gln-Ala-pNA
CAS:<p>Please enquire for more information about Ac-Ala-Gln-Ala-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H26N6O7Purity:Min. 95%Molecular weight:450.45 g/molZ-β-Ala-Gly-Gly-OH
CAS:<p>Please enquire for more information about Z-beta-Ala-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H19N3O6Purity:Min. 95%Molecular weight:337.33 g/mol1-Methylpiperidine-4-carboxylic acid hydrochloride
CAS:<p>1-Methylpiperidine-4-carboxylic acid hydrochloride is a betaine. Betaines are intermediates in the biosynthesis of phosphocholine, which is an important component of all cell membranes. 1-Methylpiperidine-4-carboxylic acid hydrochloride has been analyzed and quantified in fruits and plants such as beets, bananas, oranges, and tomatoes. It can be found in the roots of plants and has been shown to inhibit abiotic stress. This compound is also present in the human body as a result of its ingestion from food sources. 1-Methylpiperidine-4-carboxylic acid hydrochloride inhibits proline synthesis by competing with glycine for the enzyme choline acetyltransferase. It also inhibits synthesis of pipecolic acid (a precursor for histamine) by competing with glycine for the enzyme choline acetyltransferase.</p>Formula:C7H14NO2ClPurity:Min. 95%Molecular weight:179.64 g/mol1-Boc-5-Cyano-3-hydroxymethylindole
CAS:<p>Please enquire for more information about 1-Boc-5-Cyano-3-hydroxymethylindole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H16N2O3Purity:Min. 95%Molecular weight:272.3 g/molBz-Arg-betaNA·HCl
CAS:<p>Bz-Arg-betaNA·HCl is a fluorescent probe that binds to the active site of esterases. The fluorescence signal intensity is proportional to the amount of enzyme present and can be used for measuring the activity of esterases in vitro or in vivo. Bz-Arg-betaNA·HCl has been shown to have high specificity for esterases, with low affinity for other enzymes, such as proteases.</p>Formula:C23H25N5O2·HClPurity:Min. 95%Molecular weight:439.94 g/molObestatin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Obestatin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H176N32O33Purity:Min. 95%Molecular weight:2,546.83 g/molSuc-Ala-Ala-Pro-Asp-pNA
CAS:<p>Suc-Ala-Ala-Pro-Asp-pNA is a synthetic substrate that has been expressed, synthesized, and purified. It is hydrophobic with a phenylmethyl residue that is reactive. Suc-Ala-Ala-Pro-Asp-pNA has been shown to have protease activity in plate assays against serine proteases and has an acidic ph optimum. Suc-Ala-Ala-Pro-Asp-pNA also has an ionizable side chain at the reactive site and is thermostable.</p>Formula:C25H32N6O11Purity:Min. 95%Molecular weight:592.56 g/molZ-Thr(tBu)-OSu
CAS:<p>Please enquire for more information about Z-Thr(tBu)-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H26N2O7Purity:Min. 95%Molecular weight:406.43 g/molHirullin
CAS:<p>Hirullin H-Ser-Asp-Phe-Glu-Glu-Phe-Ser-Leu-Asp-Asp-Ile-Glu-Gln is a peptide with a carboxy terminal and carbonyl group. It has minimal inhibitory concentrations of about 100 nM for most bacteria and is active against the majority of Gram positive bacteria. Hirullin H is composed of amino acid sequences that are similar to the sequences of active substances in other compounds, such as hirulog, an anticoagulant, and heparin, an antithrombotic drug. Hirullin H has been shown to have bifunctional properties by inhibiting thrombin, which is responsible for blood clotting, while also inhibiting platelet activation.</p>Formula:C68H96N14O29Purity:Min. 95%Molecular weight:1,573.57 g/molH-Ala-Ala-Pro-Val-chloromethylketone
CAS:<p>H-Ala-Ala-Pro-Val-chloromethylketone is a hydrogen peroxide prodrug that is activated by the enzyme chloromethyl ketone. This drug has been shown to be active against schistosoma and pancreatic cancer cells, as well as in activating peroxide. HAPV may also have an effect on immunity and leukocytes, which could be due to its ability to sensitize these cells to damage caused by other agents, or through the hydrolytic enzymes it generates.</p>Formula:C17H29ClN4O4Purity:Min. 95%Molecular weight:388.89 g/molH-Ala-Abu-OH
CAS:<p>Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H14N2O3Purity:Min. 90%Color and Shape:PowderMolecular weight:174.2 g/molH-Leu-Gly-Arg-Ser-Gly-Gly-Asp-Ile-Ile-Lys-Lys-Met-Gln-Thr-Leu-OH
CAS:<p>Please enquire for more information about H-Leu-Gly-Arg-Ser-Gly-Gly-Asp-Ile-Ile-Lys-Lys-Met-Gln-Thr-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H125N21O21SPurity:Min. 95%Molecular weight:1,616.93 g/molMethoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt
CAS:<p>Please enquire for more information about Methoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H34N8O7Purity:Min. 95%Molecular weight:522.56 g/molMyosin Light Chain Kinase (480-501)
CAS:<p>H-AKKLSKDRMKKYMARRKWQKTG-NH2 peptide, corresponding to 480-501 amnino acids of Myosin Light Chain Kinase. Myosin Light Chain Kinase is a serine/threonine specific protein kinase that phosphorylates the myosin light chain.</p>Formula:C120H209N41O28S2Purity:Min. 95%Molecular weight:2,738.34 g/molAmyloid β-Protein (1-38) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-38) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C184H277N51O56SPurity:Min. 95%Molecular weight:4,131.54 g/mol3-Fluoro-4-methoxybenzoic acid
CAS:<p>3-Fluoro-4-methoxybenzoic acid is a dipolar molecule with a fluorine atom. It has been synthesized experimentally and the yields are determined by the experimental conditions. 3-Fluoro-4-methoxybenzoic acid has two isomers, which can be differentiated by their resonances. The molecule also has an asymmetric C3(CF)2Cl group in the middle of its structure that can rotate freely.</p>Formula:C8H7FO3Purity:Min. 95%Color and Shape:PowderMolecular weight:170.14 g/molp60 v-src (137-157)
CAS:<p>Please enquire for more information about p60 v-src (137-157) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C111H168N30O35Purity:Min. 95%Molecular weight:2,482.7 g/molL-Alanine benzyl ester hydrochloride
CAS:<p>L-Alanine benzyl ester hydrochloride is a conjugate of L-alanine and the quaternary ammonium salt benzyl ester hydrochloride. The water molecule is attached to the nitrogen atom in the benzyl ester. It has been shown to inhibit viral replication by interfering with the virus' ability to use host enzymes and proteins for synthesis. L-Alanine benzyl ester hydrochloride has significant cytotoxicity against leukemia cells, which may be due to its ability to inhibit rna polymerase activity. L-Alanine benzyl ester hydrochloride can also be used as an inhibitor of angiotensin converting enzyme (ACE), which is important in regulating blood pressure.</p>Formula:C10H13NO2•HCLPurity:Min. 95%Color and Shape:White PowderMolecular weight:215.68 g/molZ-Ala-Pro-Phe-chloromethylketone
CAS:<p>Z-Ala-Pro-Phe-chloromethylketone is a cytosolic protein that performs its function by denaturing proteins and is localized in the cytosol. It has been shown to be active against a number of bacteria, including Bacillus licheniformis and Listeria monocytogenes, as well as some fungi. Z-Ala-Pro-Phe-chloromethylketone targets the membrane potential in mitochondria and chloromethyl ketone is a strategy for inhibiting membrane potential in mitochondria. The x-ray diffraction data show that this protein forms a molecule with an alpha helix structure. It binds to the mitochondrial inner membrane by ligation and inhibits mitochondrial membrane potential.</p>Formula:C26H30ClN3O5Purity:Min. 95%Molecular weight:499.99 g/mol(Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
<p>Please enquire for more information about (Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molZ-Gly-Pro-Gly-Gly-Pro-Ala-OH
CAS:<p>Z-Gly-Pro-Gly-Gly-Pro-Ala-OH is a synthetic substrate. It is used in tissue culture to measure collagenase activity, as well as in skin cells to measure the activity of v. anguillarum. The optimum pH for this substrate is 5.5 and it has been shown to be stable in high salt environments. This substrate also reacts with human liver granulosa cells and has been shown to have neutral pH properties. Z-Gly-Pro-Gly-Gly-Pro-Ala-OH is an enzyme substrate that is involved in many different enzyme activities including protein synthesis and hydrogen bonding.</p>Formula:C27H36N6O9Purity:Min. 95%Molecular weight:588.61 g/molb-Alanine methyl ester hydrochloride
CAS:<p>b-Alanine methyl ester hydrochloride is a fatty acid that is found in animal and plant tissues. It is a bifunctional molecule that can act as an inhibitor of serine proteases and also as an activator of fatty acid uptake by cells. This molecule has the potential to be used for the treatment of heart disease and other conditions caused by activation of serine proteases.</p>Formula:C4H9NO2·HClPurity:Min. 95%Color and Shape:White PowderMolecular weight:139.58 g/molH-Gly-Pro-Gly-Gly-OH
CAS:<p>H-Gly-Pro-Gly-Gly-OH is a peptide that has been shown to have anti-inflammatory properties. It is an amide with four amino acids, Glycine, Proline, Glycine and Hydroxyproline. The terminal residues of this peptide are Glycine and Hydroxyproline. The optical properties of this peptide include the absorption maximum at 264 nm and the extinction coefficient at 25°C is approximately 5200 M−1 cm−1. This amide also has been clinically studied for its effects in humans with inflammatory disease such as arthritis. Kinetic studies have shown that this peptide binds to protein data through site specific interactions and molecular electrostatic potential simulations have shown that the chelate ring on the tetrapeptide interacts with the protein data.</p>Formula:C11H18N4O5Purity:Min. 95%Molecular weight:286.28 g/molAsn-Ala-Intercellular Adhesion Molecule 1 (1-21) (human)
CAS:<p>Please enquire for more information about Asn-Ala-Intercellular Adhesion Molecule 1 (1-21) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C99H173N29O32SPurity:Min. 95%Molecular weight:2,313.68 g/molH-Leu-Ser-Phe-OH
CAS:<p>H-Leu-Ser-Phe-OH is a synthetic molecule that is a serine protease. It has been shown to have phosphatase activity, which can be used in the processing of milk proteins. This enzyme can also be used in the production of acid casein and colostrum. The enzyme has been shown to convert aspartic acid into asparagine, which is then converted into aminosugars such as melamine and phenylalanine. H-Leu-Ser-Phe-OH can be used for the treatment of fibrinogen deficiency, with its ability to cleave fibrinogen at the γ site. The enzyme has also been shown to have an effect on blood coagulation by cleaving fibrinogens at the γ site, thus preventing clot formation.</p>Formula:C18H27N3O5Purity:Min. 95%Molecular weight:365.42 g/molH-Gly-Sar-Sar-OH
CAS:<p>H-Gly-Sar-Sar-OH is an amide that is a prodrug for the antibiotic Glycylcycline. This drug has been shown to inhibit peptidases and transport in caco-2 cells, as well as to have affinity for intestinal peptidases. H-Gly-Sar-Sar-OH has also been shown to be able to penetrate the cell membrane and inhibit peptidase activity in extracellular space. The bond cleavage of this drug has been rationalized by comparing it with other bioisosteres.</p>Formula:C8H15N3O4Purity:Min. 95%Molecular weight:217.22 g/molH-Gly-Pro-bNA
CAS:<p>H-Gly-Pro-bNA is a glycylproline amino acid sequence that is synthesized by the enzyme neutral endopeptidase. It has been found in tissues, such as hamster liver and human liver, and has been shown to be resistant to hydrolysis by peptidases. The H-Gly-Pro-bNA sequence is amphipathic, meaning it can exist in both water and lipid environments. H-Gly-Pro-bNA has been shown to be a substrate for hydroxylase activity, which converts it into an amino acid with a hydroxyl group at its alpha carbon. This amino acid can then bind to polyacrylamide gel electrophoresis under denaturing conditions.</p>Formula:C17H19N3O2Purity:Min. 95%Molecular weight:297.35 g/molFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H47FN4O15Purity:Min. 95%Molecular weight:878.85 g/molMatrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt
CAS:<p>Please enquire for more information about Matrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H75N9O11·C2HF3O2Purity:Min. 95%Molecular weight:1,080.2 g/molN-Heptyl-Hyp-OH
CAS:<p>The synthesis of N-heptyl-hyp-OH is a chiral resolution process for the preparation of the enantiomers of heptanol. The enantioselective synthesis of this compound is achieved by converting the racemic mixture to an optically active form by means of a chiral auxiliary, followed by protection and hydrolysis. This method produces an optically pure product in high yield.</p>Formula:C12H23NO3Purity:Min. 95%Molecular weight:229.32 g/mol(D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C136H210N40O31SPurity:Min. 95%Molecular weight:2,933.44 g/molHydrin 1
CAS:<p>Hydrin 1 is a fatty acid that is expressed in the apical membrane of bladder cells, which are the cells that line the urinary tract. It is also found in the blood vessels and heart. Hydrin 1 has been shown to have biological properties such as being taken up by water, interacting with other molecules, and forming reaction products. The ventral part of the cell membrane is where Hydrin 1 is mostly expressed, but it can also be found in other parts of the organism. Hydrin 1 binds to messenger RNA and has been used as a model system for studying protein-lipid interactions. The effective dose for Hydrin 1 is not known. This drug can be conjugated with bile salts to form an active metabolite called hydroxylinoleic acid (HOLA). HOLA binds to receptors on vascular smooth muscle cells and lowers blood pressure by decreasing peripheral resistance and vascular tone.</p>Formula:C57H93N21O16S2Purity:Min. 95%Molecular weight:1,392.61 g/mol3,5-Dichloro-4-methylpyridine
CAS:<p>Please enquire for more information about 3,5-Dichloro-4-methylpyridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H5Cl2NPurity:Min. 95%Molecular weight:162.02 g/molFmoc-Arg(Pbf)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Arg(Pbf)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Lys-Lys-(Hyp 3,b-(2-thienyl)-Ala5·8,D-Phe7)-Bradykinin
CAS:<p>Please enquire for more information about Lys-Lys-(Hyp 3,b-(2-thienyl)-Ala5·8,D-Phe7)-Bradykinin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H95N19O14S2Purity:Min. 95%Molecular weight:1,394.67 g/molTos-Gly-Pro-Arg-AMC·HCl
CAS:<p>Please enquire for more information about Tos-Gly-Pro-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H37N7O7S·HClPurity:Min. 95%Molecular weight:676.18 g/molN-α-Fmoc-Nε-allyloxycarbonyl-D-lysine
CAS:<p>N-alpha-Fmoc-Nepsilon-allyloxycarbonyl-D-lysine is a medicament that is modified with an amino group at the alpha position. It is synthesized by modification of the chain with a ganirelix acetate. N-alpha-Fmoc-Nepsilon-allyloxycarbonyl-D-lysine can be used to produce ganirelix, which inhibits the release of follicle stimulating hormone (FSH). The chemical synthesis of this drug has been shown to be successful in large scale production, and it has been shown to be effective in treating patients with prostate cancer. Impurities in this drug have been found and treated by removing the methyl ester group from the lysine residue.</p>Formula:C25H28N2O6Purity:Min. 95%Molecular weight:452.5 g/mol(D-Arg1,D-Pro2,D-Trp7·9,Leu11)-Substance P
CAS:<p>Substance P is a tachykinin that is released from the nerve endings of the parasympathetic nervous system. It binds to receptors in the plasma membrane of cells and causes them to release acetylcholine, which is an inhibitory neurotransmitter. Substance P also has been shown to interact with muscle cells and cause contractions. The incubation of Substance P with muscle cells inhibits the release of calcium ions, which reduces the membrane potential and decreases the contractility of these cells.</p>Formula:C75H108N20O13Purity:Min. 95%Molecular weight:1,497.79 g/molH-Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys-Ala-OH trifluoroacetate salt (Disulfide bond between Pen2 and Cys9)
CAS:<p>Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys (GPEG) is a peptide that modulates the function of muscle cells and is present in collagen. GPEG has been shown to improve oxidative damage, which occurs during exercise. The effect of GPEG on muscle cells is dependent on the dose. Low doses of GPEG activate proteins that are involved in transcription and increases the synthesis of oxidative enzymes, while high doses inhibit these proteins. GPEG also modulates integrin receptor expression and decreases fibronectin production by vascular smooth muscle cells.</p>Formula:C35H57N13O14S2Purity:Min. 95%Molecular weight:948.04 g/mol(D-Phe6,Leu-NHEt 13,des-Met14)-Bombesin (6-14) trifluoroacetate salt
CAS:<p>Bombesin is a peptide hormone that is secreted by the intestines and the pancreas. Bombesin stimulates the adrenal glands to release adrenaline, which in turn stimulates the bladder to contract. Bombesin has been shown to increase bladder efficiency significantly when given intravenously to patients with chronic urinary retention. This drug also has significant effects on pain syndrome, as it can facilitate or inhibit pain depending on its concentration. Bombesin's mechanism of action is still unclear, but it may work by antagonizing other neurotransmitters like noradrenaline or adrenaline.</p>Formula:C49H69N13O9Purity:Min. 95%Molecular weight:984.15 g/mol(R)-2-Methyl-5-(prop-1-en-2-yl)cyclohex-2-enone
CAS:<p>(R)-2-Methyl-5-(prop-1-en-2-yl)cyclohex-2-enone is an organic compound that has been shown to induce apoptosis in prostate cancer cells. The mechanism of this induction is not yet fully understood, but it may be due to the inhibition of the synthesis of proteins required for cell division. It also had a significant effect on locomotor activity in mice. This compound has been shown to have acute toxicities, and its phase transition temperature is below room temperature. It can be used as a fumigant and an inorganic acid, and it has been proposed as a potential fluorescence probe for natural compounds.</p>Purity:Min. 95%(2S,3S)-(-)-3-Amino-2-phenylpiperidine
CAS:<p>The process of asymmetric epoxidation is used to convert alkenes into epoxides in a single step. This reaction is catalyzed by the use of a chiral catalyst with an enantiomeric excess (ee) greater than 50%. The reactants are added to the catalyst and hydrogen peroxide, which oxidizes the alkenes. The resulting epoxides can be isolated from the reaction mixture by distillation or extraction. Factors that affect this reaction include the type of reactant, solvent, temperature, and pressure.</p>Formula:C11H16N2Purity:Min. 95%Molecular weight:176.26 g/molDolastatin 15 (5S)-1-[(2S)-O-(N,N-Dimethyl-Val-Val-N-Me-Val-Pro-Pro)-2-hydroxyisovaleryl]-2-oxo-4-methoxy-5-benzyl-3-pyrroline
CAS:<p>Dolastatin 15 (5S)-1-[(2S)-O-(N,N-Dimethyl-Val-Val-N-Me-Val-Pro-Pro)-2-hydroxyisovaleryl]-2-oxo-4-methoxy-5-benzylpyrrolidinium is a natural compound that has been isolated from the Indian Ocean sea hare Dolabella auricularia. It has shown significant cytotoxicity against cancer cells as well as significant immunosuppressive activities in animals. Dolastatin 15 is an analog of dolastatin 10 and has been shown to be active against hepatitis B and C virus. It also has antiinflammatory properties and may be effective in combating autoimmune diseases. The synthesis of this compound is an asymmetric synthesis with a hydroxyl group on one side of the molecule and an amide on the other side.</p>Formula:C45H68N6O9Purity:Min. 95%Molecular weight:837.06 g/molH-Tyr-Tyr-NH2·HCl
CAS:<p>Please enquire for more information about H-Tyr-Tyr-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H21N3O4·HClPurity:Min. 95%Molecular weight:379.84 g/molFibrinopeptide B (human) trifluoroacetate salt
CAS:<p>Fibrinopeptide B is a fibrinogen-derived peptide that has shown to inhibit the growth of HL-60 cells. It may be active as a receptor antagonist for thrombin and caproic acid. Fibrinopeptide B also inhibits angiogenesis by inhibiting the binding of acidic, basic proteins to the vascular endothelium in atherosclerotic lesions. The biological sample can be obtained from human serum or plasma.</p>Formula:C66H93N19O25Purity:Min. 95%Molecular weight:1,552.56 g/molEnterostatin (human, mouse, rat) acetate salt
CAS:<p>Enterostatin is a peptide hormone that inhibits the release of insulin, gastric acid and pancreatic juices. Enterostatin has been shown to have a number of biological properties, including an anti-obesity effect in humans. In mice, enterostatin has been shown to decrease food intake, increase energy expenditure and weight loss. Enterostatin also decreases the levels of serum cholesterol and triglycerides in rats. This drug has a number of pharmacological activities including inhibition of platelet aggregation and vasodilation. Enterostatin is related to peptide hormones such as ghrelin, which stimulates appetite, and cholecystokinin (CCK), which reduces appetite. It may be used as an alternative treatment for obesity or metabolic disorders like diabetes mellitus type 2 or hyperlipidaemia.</p>Formula:C21H36N8O6Purity:Min. 95%Molecular weight:496.56 g/molBoc-Gly-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Gly-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Dynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about Dynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H95ClN20O12Purity:Min. 95%Molecular weight:1,323.98 g/molL-allo-Threoninol
CAS:<p>Please enquire for more information about L-allo-Threoninol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C4H11NO2Purity:Min. 95%Color and Shape:Colourless To Pale Yellow LiquidMolecular weight:105.14 g/molMet-Enkephalin-Arg-Phe
CAS:<p>Met-enkephalin is a 5-hydroxytryptamine (serotonin) agonist. It has been shown to have anesthetic properties and to be active in cardiac, pulmonary, and renal functions. Met-enkephalin has also been found to have a delta-opioid receptor activity. This molecule has been shown to inhibit noradrenaline release from the locus coeruleus, as well as immunohistochemically demonstrating its presence at the atrium of the heart. Met-enkephalin also exhibits hydroxylase activity and has been shown to inhibit dopamine release from the substantia nigra pars compacta and sinoatrial node in rats. This drug can be used for treatment of pain, hypertension, angina pectoris, myocardial infarction, unstable angina, cardiogenic shock, congestive heart failure due to left ventricular dysfunction or ischemia of the coronary artery, acute pulmonary edema</p>Formula:C42H56N10O9SPurity:Min. 95%Molecular weight:877.02 g/mol(Deamino-Pen 1,Val4,D-Arg8)-Vasopressin
CAS:<p>Vasopressin is a peptide hormone that regulates water balance. It is synthesized in the hypothalamus and stored in the posterior pituitary gland, from where it is released when blood pressure falls. Vasopressin binds to V1 receptors in the kidney and vascular smooth muscle cells, causing vasoconstriction and increased blood pressure. Vasopressin also stimulates phosphatidic acid synthesis and hypotension, which are mediated through V2 receptors. Vasopressin has been found to be effective against cardiac arrest and myocardial infarction in animals. This drug has also been shown to stimulate the paraventricular nucleus of the hypothalamus and inhibit sympathetic activity in ganglia.</p>Formula:C48H69N13O11S2Purity:Min. 95%Molecular weight:1,068.27 g/molHeat Shock Protein (hsp) Fragment trifluoroacetate salt
CAS:<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H113N22O25PSPurity:Min. 95%Molecular weight:1,641.74 g/molZ-Arg-Arg-4MbetaNA acetate salt
CAS:<p>Please enquire for more information about Z-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H41N9O5·C2H4O2Purity:Min. 95%Molecular weight:679.77 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C195H300N56O56SPurity:Min. 95%Molecular weight:4,356.88 g/molH-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H118N40O12S2Purity:Min. 95%Molecular weight:1,679.99 g/molFmoc-Ala-Pro-OH
CAS:<p>Fmoc-Ala-Pro-OH is a peroxide that can be used as a radical initiator for the synthesis of polymers, such as polypropylene. It has been shown to catalyze the oxidation of hydrogen peroxide by a phenoxy group to form radicals. The rate of formation of these radicals is highly dependent on the number and location of proline residues in the molecule. Fmoc-Ala-Pro-OH is chemically stable and does not react with oxygen or light.</p>Formula:C23H24N2O5Purity:Min. 95%Molecular weight:408.45 g/molZ-Glu-Leu-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Z-Glu-Leu-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H26N2O7·C12H23NPurity:Min. 95%Molecular weight:575.74 g/mol4-Methyl-5-formylthiazole
CAS:<p>4-Methyl-5-formylthiazole is a synthetic molecule with in vitro antifungal activity. It has been shown to inhibit the growth of Candida albicans and Aspergillus niger, two species of fungi that are responsible for the majority of opportunistic infections in immunocompromised patients. 4-Methyl-5-formylthiazole is a nucleophilic molecule that undergoes electrophilic substitution reactions, which makes it an efficient method for generating antifungal agents. The synthesis of this compound can be achieved through the condensation of methyl formate and thiourea, followed by treatment with chloride ion to produce the desired product. 4-Methyl-5-formylthiazole is also fluorescent and has electron deficient properties, which makes it useful for diagnosis and molecular modelling.</p>Formula:C5H5NOSPurity:Min. 95%Molecular weight:127.17 g/molH-Lys-Gln-Ala-Gly-Asp-Val-OH
CAS:<p>H-Lys-Gln-Ala-Gly-Asp-Val-OH is a synthetic peptide that is used as a research tool. It is synthesized by recombinant e. coli cells and has been shown to have strong affinity for the specific ligand, fluorescence and microbial assays. This synthetic peptide is hydrophilic and can be detected using confocal microscopy. It also exhibits biodegradability in an e. coli environment, which may be due to its lysine residue.</p>Formula:C25H44N8O10Purity:Min. 95%Molecular weight:616.66 g/molH-Met-Ser-OH
CAS:<p>H-Met-Ser-OH is a dihedral molecule that has an amino acid composition of H, Met, Ser, and OH. It is acidic and has efficiencies in polarizability and acceptor. The dipole moment of the molecule is hydrogen bonding interactions with sequences. The vibrational frequencies are computationally predicted by computational methods. The sulfate fractionation was used to determine the percent of H-Met-Ser-OH in human liver tissue.</p>Formula:C8H16N2O4SPurity:Min. 95%Molecular weight:236.29 g/molH-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Ala-Glu-Phe-OH
CAS:<p>Please enquire for more information about H-Glu-Leu-Asp-[(2R,4S,5S)-5-amino-4-hydroxy-2,7-dimethyl-octanoyl]-Ala-Glu-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H65N7O15Purity:Min. 95%Molecular weight:908 g/molNeuromedin N trifluoroacetate salt
CAS:<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>Formula:C38H63N7O8Purity:Min. 95%Molecular weight:745.95 g/molN-(4-Methoxybenzylidene)-4-butylaniline
CAS:<p>N-(4-Methoxybenzylidene)-4-butylaniline is an organic compound that belongs to the group of liquid crystals. It has been used in the study of phase transitions and thermal properties. The melting point of N-(4-methoxybenzylidene)-4-butylaniline is between -80 and -90 °C, depending on the solvent. This compound has a low proton affinity, but it can be oxidized to form a radical cation.</p>Formula:C18H21NOPurity:Min. 95%Molecular weight:267.37 g/molFmoc-β-cyclohexyl-D-alanine
CAS:<p>Fmoc-beta-cyclohexyl-D-alanine is a fragment of the cyclic peptide cyclohexylalanine and has been shown to inhibit cell growth in culture. It binds to DNA in a transcriptional manner and induces apoptosis, which is characterized by dna fragmentation. Fmoc-beta-cyclohexyl-D-alanine also inhibits extracellular signal-regulated kinase (ERK) activity, leading to reduced expression of antiapoptotic proteins such as Bcl2 and BclXL. This drug has been shown to induce apoptosis in cells that have been transfected with an antiapoptotic vector.</p>Formula:C24H27NO4Purity:Min. 95%Molecular weight:393.48 g/molBz-D-Thr-OMe
CAS:<p>Bz-D-Thr-OMe is a synthetic peptide with an amino acid sequence of Bz-D-Thr-OH. It has the chemical formula C14H24N2O4S and a molecular weight of 288.4 g/mol. This peptide reacts selectively with the n-terminal amino and carboxylic acids in peptides, cleaving the peptide bonds between these residues to produce free amino acids.</p>Formula:C12H15NO4Purity:Min. 95%Molecular weight:237.25 g/molLeptin tifluoroacetic acid (150-167)
CAS:<p>Leptin tifluoroacetic acid (150-167) is a diagnostic agent that can be used to measure leptin in vivo. Leptin tifluoroacetic acid (150-167) is an agonist for the leptin receptor, which has been shown to have effects on locomotor activity, body weight and body mass index in animals. Leptin tifluoroacetic acid (150-167) has also been shown to have anti-inflammatory properties and may be of use in the treatment of bowel diseases such as inflammatory bowel disease or bowel disease. Leptin tifluoroacetic acid (150-167) binds with high affinity to human fat cells, allowing it to be used as a marker for fat cell differentiation and energy metabolism. The main function of leptin is regulation of food intake and energy expenditure by acting on receptors in the brain, liver, muscle and other tissues.</p>Formula:C87H138N22O28S2•(CF3CO2H)xPurity:Min. 95%Molecular weight:2,004.29 g/molFmoc-Gly-(Dmb)Gly-OH
CAS:<p>Fmoc-Gly-(Dmb)Gly-OH is a synthetic peptide that modulates cellular activity. It encompasses a wide range of activities, such as cancer cell growth and restenosis, fibroid tumors and bowel disease. Fmoc-Gly-(Dmb)Gly-OH has been shown to be an effective chemotherapeutic agent in the treatment of age-related macular degeneration and retinopathy. It also inhibits inflammatory bowel disease and infarction by restricting the production of inflammatory cytokines, such as TNFα, IL1β, and IL6. Fmoc-Gly-(Dmb)Gly-OH can be used to treat endometriosis by inhibiting angiogenesis in the uterus.</p>Formula:C28H28N2O7Purity:Min. 95%Molecular weight:504.53 g/molUrotensin II-Related Peptide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Urotensin II is a peptide that is expressed in the brain and has hypotensive effects. It is an endogenous ligand for the urotensin II receptor, which is found in various tissues including the heart, vascular system, and lungs. Urotensin II-Related Peptide (URP) was identified from cDNA sequences of human, mouse, and rat tissues. The URP consists of a sequence of amino acids with a molecular weight of 1219. This peptide has been shown to have diagnostic use in tissues and animals as well as being immunoreactive in monoclonal antibodies. The gene encoding URP has been cloned and its protein product has been characterized by mass spectroscopy.</p>Formula:C49H64N10O10S2Purity:Min. 95%Molecular weight:1,017.23 g/mol2-Cyclohexyl-2-hydroxy-phenylacetic acid
CAS:<p>2-Cyclohexyl-2-hydroxy-phenylacetic acid is a potent inhibitor of the cholinergic muscarinic receptors. It has been used as an anticholinergic drug and in pharmaceutical preparations for the treatment of inflammatory diseases. 2-Cyclohexyl-2-hydroxy-phenylacetic acid is used to treat urinary incontinence, although it can also cause constipation. Side effects of 2-cyclohexyl-2-hydroxy phenylacetic acid include headache, drowsiness, dry mouth, and blurred vision. 2 CPHPA is an inorganic acid that reacts with phosphorus pentachloride to form an organic phosphate ester called pentachlorophosphoric acid (PCPA). This reaction can be reversed by adding hydrochloric acid. The PCPA salt of 2 CPHPA is called diethylamine salt.</p>Formula:C14H18O3Purity:Min. 95%Molecular weight:234.29 g/molFmoc-p-nitro-Phe-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-p-nitro-Phe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Tyr-Thr-NH2 hydrochloride salt
CAS:<p>Please enquire for more information about H-Tyr-Thr-NH2 hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H19N3O4Purity:Min. 95%Molecular weight:281.31 g/molFmoc-Gln(Trt)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Gln(Trt)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Tyr1)-TRAP-7 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr1)-TRAP-7 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H67N11O10Purity:Min. 95%Molecular weight:922.08 g/molH-Glu-Glu-Lys-Leu-Ile-Val-Val-Ala-Phe-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu-Glu-Lys-Leu-Ile-Val-Val-Ala-Phe-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H82N10O14Purity:Min. 95%Molecular weight:1,047.25 g/molPreangiotensinogen (11-14) (human) acetate salt
CAS:<p>Please enquire for more information about Preangiotensinogen (11-14) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H35N7O6Purity:Min. 95%Molecular weight:481.55 g/molZ-Tyr-Lys-Arg-pNA·2 TFA
CAS:<p>Z-Tyr-Lys-Arg-pNA·2 TFA is a potent inhibitor of proteases. It has been shown to be an efficient inhibitor of the major yeast protease, proteinase A, and other enzymes that are used for the industrial production of peptides. Z-Tyr-Lys-Arg-pNA·2 TFA is a synthetic peptide with a molecular mass of 5,836 Da and an optimum pH of 7.5. This peptide is synthesized by the chemical reaction between butoxycarbonyl (Boc) Lys(Z)-Tyr(N)-Arg(R)-pNA and 2 equivalents of trifluoroacetic acid (TFA). The synthesis takes place in a homogenous solution in dichloromethane at room temperature in the presence of triethylamine as base. Filtration through a 0.22 μm filter removes any insoluble impurities from the solution.</p>Formula:C35H45N9O8·2C2HF3O2Purity:Min. 95%Molecular weight:947.83 g/molAnthranilyl-HIV Protease Substrate V trifluoroacetate salt
CAS:<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate V trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H76N14O13Purity:Min. 95%Molecular weight:1,081.23 g/molAcetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C127H205N37O40Purity:Min. 95%Molecular weight:2,890.21 g/molH-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2
CAS:<p>H-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2 is a compound which is structurally related to the amino acid histidine. It has been used as an indicator for Xanthochromia, a diagnostic for copper. H-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2 has also been used in polyester production and as a monitoring agent for modifications of polylactic acid thermally.</p>Formula:C40H69N11O8Purity:Min. 95%Molecular weight:832.05 g/mol4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid
CAS:<p>4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid is an organic compound. It is a white solid that is insoluble in water but soluble in organic solvents. The molecule has a molecular weight of 224.8 g/mol and contains a carbonyl group and amine functional groups. 4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid can be prepared by the acylation of 4-(aminomethyl)-benzoic acid with imidazole hydrochloride in the presence of sodium carbonate as a base.</p>Formula:C13H18N2O2Purity:Min. 95%Molecular weight:234.29 g/molH-Lys(Mtt)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Lys(Mtt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Thr28, Nle 31)-Cholecystokinin-33 (25-33) (sulfated)
CAS:<p>Please enquire for more information about (Thr28, Nle 31)-Cholecystokinin-33 (25-33) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H74N14O18SPurity:Min. 95%Molecular weight:1,251.33 g/molFmoc-D-Lys(Trt)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Lys(Trt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H38N2O4Purity:Min. 95%Molecular weight:610.74 g/molPlatelet Factor 4 (58-70) (human)
CAS:<p>Please enquire for more information about Platelet Factor 4 (58-70) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C76H133N17O18Purity:Min. 95%Molecular weight:1,572.97 g/mol(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)
CAS:<p>Please enquire for more information about (Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H303N59O53Purity:Min. 95%Molecular weight:4,309.85 g/molN-Boc-D-b-homoproline
CAS:<p>Please enquire for more information about N-Boc-D-b-homoproline including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molH-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H59N12O13PPurity:Min. 95%Molecular weight:1,055.04 g/mol1-O-(cis-9-Octadecenyl)-2-O-acetyl-sn-glycero-3-phosphocholine
CAS:<p>1-O-(cis-9-Octadecenyl)-2-O-acetyl-sn-glycero-3-phosphocholine (Biotinylated BSA) is a categorized lipid that contains both carbohydrates and lipids. It is used to inseminate dairy cattle, but also has potential as a biomarker for fertility and metabolic diseases. Biotinylated BSA contains conjugates of fatty acids, which are important compounds in metabolism. The metabolome of biotinylated BSA includes nucleotides, carboxylic acids, and purines.</p>Formula:C28H56NO7PPurity:Min. 95%Molecular weight:549.72 g/molCecropin B (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cecropin B (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C176H301N51O42SPurity:Min. 95%Molecular weight:3,835.66 g/molH-Gly-Leu-Leu-Gly-OH
CAS:<p>Please enquire for more information about H-Gly-Leu-Leu-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H30N4O5Purity:Min. 95%Molecular weight:358.43 g/molTrt-Met-OH·DEA
CAS:<p>Please enquire for more information about Trt-Met-OH·DEA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H25NO2S·C4H11NPurity:Min. 95%Molecular weight:464.66 g/molAc-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C104H146N24O23SPurity:Min. 95%Molecular weight:2,132.49 g/molAdrenomedullin (16-31) (human, pig)
CAS:<p>Please enquire for more information about Adrenomedullin (16-31) (human, pig) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H129N25O21S2Purity:Min. 95%Molecular weight:1,865.19 g/molBoc-Thr(Bzl)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Thr(Bzl)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Acarbose 1,1-a,a-glycoside
CAS:<p>Please enquire for more information about Acarbose 1,1-a,a-glycoside including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H43NO18Purity:Min. 95%Molecular weight:645.6 g/molCionin
CAS:<p>Cionin is a synthetic peptide that binds to the pancreatic enzyme receptor. It has been shown to inhibit the growth of ascidian and stimulates the secretion of growth factors in vitro. Cionin also has a physiological effect on inflammatory diseases, such as ovary. Cionin is composed of three amino acids: H-Asn-Tyr(SO3H)-Tyr(SO3H)-Gly-Trp-Met-Asp-Phe-NH2. The first two amino acids are sulfated tyrosine residues, which may be responsible for its biological activity.</p>Formula:C53H63N11O19S3Purity:Min. 95%Molecular weight:1,254.33 g/molAc-Ala-Ala-Ala-Ala-OMe
CAS:<p>Ac-Ala-Ala-Ala-Ala-OMe is a peptidase that hydrolyzes the ester bonds of the hydrophobic amino acid residues, such as alanine, valine, leucine, and isoleucine. This enzyme deacylates and releases these amino acids from the side chain of their corresponding fatty acyl groups. Ac-Ala-Ala-Ala-Ala-OMe also acts on N terminal and C terminal residues. The presence of a scissile bond in the peptide substrate is required for this enzyme to function. Acetylation reactions are concurrent with acylation reactions, which produce an acetylated peptide product.</p>Formula:C15H26N4O6Purity:Min. 95%Molecular weight:358.39 g/mol5-Amino-2-methoxyisonicotinic acid
CAS:<p>5-Amino-2-methoxyisonicotinic acid is a carboxylic acid that is used in the synthesis of aminopyridines. The compound can be synthesized from formamidine acetate and diethyl dicarbonate. This process involves lithiation, followed by addition of an amine and finally conversion to the desired product with formamidine acetate. 5-Amino-2-methoxyisonicotinic acid can also be synthesized from formamide and diethyl ether. 5-Amino-2-methoxyisonicotinic acid is an analog of 2,4,6-trimethylaniline and has been shown to have similar properties to this compound, including strong basicity.</p>Formula:C7H8N2O3Purity:Min. 95%Molecular weight:168.15 g/molBoc-Gly-Gly-Leu-pNA
CAS:<p>Boc-Gly-Gly-Leu-pNA is an analog of the protease inhibitor serine protease. It has a reactive site that is similar to the reactive site on serine proteases. This enables Boc-Gly-Gly-Leu-pNA to bind to them and inhibit their activity. The compound also inhibits neutrophil activation, as shown by a decrease in its expression of CD11b and CD11c, which are markers of neutrophils.</p>Formula:C21H31N5O7Purity:Min. 95%Molecular weight:465.5 g/molPmc-S-methylisothiourea
CAS:<p>Pmc-S-methylisothiourea is a synthetic compound that is used as a cross-coupling agent in organic synthesis. It has been shown to be an efficient and selective catalyst for Suzuki reactions. Pmc-S-methylisothiourea can be used to synthesize isoforms of macrolides, which are compounds with a skeleton similar to penicillin. Pmc-S-methylisothiourea can also be modified by adding ligands, such as thyronine, which can bind to hormone receptors and regulate transcription.</p>Formula:C16H24N2O3S2Purity:Min. 95%Color and Shape:PowderMolecular weight:356.51 g/molN-Methyl-1,2-phenylenediamine dihydrochloride
CAS:<p>N-Methyl-1,2-phenylenediamine dihydrochloride (NMP) is a synthetic compound that is used as the precursor to various pharmaceuticals, such as the antihypertensive drug clonidine. NMP can be synthesized from benzene and ammonia or phenylmagnesium bromide. It is carcinogenic in animals and humans, and has been shown to cause DNA damage and cell apoptosis. The chemical has a high potential for nitrosation reactions when exposed to nitrites. This reaction produces nitric oxide, which is cytotoxic and can lead to liver cancer in rats.<br>The synthesis of NMP generates impurities such as methanol solvent, sodium sulfide, and hydrogen chloride gas. These impurities are often found in recycled NMP due to incomplete removal during processing.</p>Formula:C7H12Cl2N2Purity:Min. 95%Color and Shape:PowderMolecular weight:195.09 g/molFmoc-Homoarg (Z)2-OH
CAS:<p>Please enquire for more information about Fmoc-Homoarg (Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H38N4O8Purity:Min. 95%Molecular weight:678.73 g/molGRF (1-29) amide (rat)
CAS:<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formula:C155H251N49O40SPurity:Min. 95%Molecular weight:3,473.02 g/molH-Gly-Leu-Tyr-OH
CAS:<p>H-Gly-Leu-Tyr-OH is a tripeptide that is found in some human and animal proteins. The peptide contains glycine, leucine, tyrosine, and hydroxyproline. It binds to copper ions with an inhibition constant of 1.5 x 10^5 M and has a pH optimum of 7.0. In the active form, it inhibits α subunit of bacterial aminopeptidase which is required for protein synthesis in bacteria. The peptide also has been shown to be a model system for the study of enzyme mechanisms and as a chromatographic method for analyzing proteins in food chemistry.</p>Formula:C17H25N3O5Purity:Min. 95%Molecular weight:351.4 g/molFmoc-Tyr(PO3(MDPSE)2)-OH
CAS:<p>Please enquire for more information about Fmoc-Tyr(PO3(MDPSE)2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H54NO8PSi2Purity:Min. 95%Molecular weight:932.15 g/molH-Gly-His-OH·HCl
CAS:<p>H-Gly-His-OH·HCl is a methyl ester of histidine. It has an axial orientation, and the optical rotation is +25.4° (c=1 in methanol). H-Gly-His-OH·HCl is synthesized from glutamic acid, glutamate, and imidazole by using a method based on the catalytic properties of copper. H-Gly-His-OH·HCl can be used as a ligand for the enzyme peroxidase, which catalyzes oxidation reactions with hydrogen peroxide or organic peroxides to form water and oxidized products. The efficiency of this reaction increases with increasing concentrations of H-Gly-His-OH·HCl.<br>!--END--></p>Formula:C8H12N4O3·HClPurity:Min. 95%Molecular weight:248.67 g/molH-Cys(farnesyl)-Val-Ile-Ser-OH
CAS:<p>Please enquire for more information about H-Cys(farnesyl)-Val-Ile-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H56N4O6SPurity:Min. 95%Molecular weight:624.88 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molBoc-N-Methyl-γ-aMinobutyric acid
CAS:<p>Please enquire for more information about Boc-N-Methyl-gaMMa-aMinobutyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19NO4Purity:Min. 95%Molecular weight:217.26 g/molpTH (18-48) (human)
CAS:<p>Please enquire for more information about pTH (18-48) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C156H251N47O43SPurity:Min. 95%Molecular weight:3,505.02 g/mol4-Fluoro-2-methoxyaniline
CAS:<p>4-Fluoro-2-methoxyaniline is an inhibitor of tyrosine kinase. It is a molecule that has been isolated from the ground leaves of erythroxylon coca and is used in the treatment of diabetes mellitus. 4-Fluoro-2-methoxyaniline inhibits the growth factor receptor, epidermal growth factor (EGF), and its receptor, EGF receptor. This inhibition leads to decreased proliferation of epidermal cells and decreased insulin production by pancreatic beta cells. 4-Fluoro-2-methoxyaniline also has antioxidant properties, which may be due to its ability to scavenge free radicals.</p>Formula:C7H8FNOPurity:Min. 95%Color and Shape:Light Brown To Brown LiquidMolecular weight:141.14 g/molH-Asp-Asp-Asp-OH
CAS:<p>H-Asp-Asp-Asp-OH is a peptide that has been shown to disrupt the cytosol and cause apoptosis. It can also induce proteolytic maturation and modulate autocatalytic functions. H-Asp-Asp-Asp-OH induces apoptosis by activating caspase 9 and caspase 3, which cleaves poly (ADP ribose) polymerase (PARP). This leads to DNA fragmentation, chromatin condensation, nuclear fragmentation, cell shrinkage, membrane blebbing, and nuclear pyknosis. H-Asp-Asp-Asp-OH binds to the regulatory domain of caspase 9 and prevents it from being activated. The peptide also activates caspase 8 by binding to its regulatory domain, which then activates caspases 3 and 7. H-Asp-Asp-Asp-OH also stimulates the release of granzyme B from cytot</p>Formula:C12H17N3O10Purity:Min. 95%Molecular weight:363.28 g/molH-Met-D-Met-OH
CAS:<p>Please enquire for more information about H-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O3S2Purity:Min. 95%Molecular weight:280.41 g/molZ-Phe-Glu-OH
CAS:<p>Please enquire for more information about Z-Phe-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H24N2O7Purity:Min. 95%Molecular weight:428.44 g/molBoc-Ala-Ala-Pro-OH
CAS:<p>Boc-Ala-Ala-Pro-OH is a tetrapeptide that is expressed in mammalian cells. It has been shown to have transcription-polymerase chain activity and can be used as a molecular modeling tool for the study of mutant enzymes. Boc-Ala-Ala-Pro-OH is an analog of the natural tetrapeptide Arg-Gly, which has been shown to be activated by proteolytic cleavage and complementarity with other tetrapeptides.</p>Formula:C16H27N3O6Purity:Min. 95%Molecular weight:357.4 g/mol1-Methyl-1H-indazole-7-carbaldehyde
CAS:<p>1-Methyl-1H-indazole-7-carbaldehyde is a 1,3,5-substituted indazole derivative that can be used as a building block for the synthesis of complex compounds. It is an intermediate in the synthesis of various pharmaceuticals and it has been shown to have potential applications in research chemicals. 1-Methyl-1H-indazole-7-carbaldehyde can be used as a versatile building block after conversion to other derivatives. This chemical is also being investigated as a possible treatment for Parkinson's disease and Alzheimer's disease.</p>Formula:C9H8N2OPurity:Min. 95%Color and Shape:Yellow PowderMolecular weight:160.17 g/molFor-Nle-Leu-Phe-Nle-Tyr-Lys-OH
CAS:<p>For-Nle-Leu-Phe-Nle-Tyr-Lys-OH is an amino acid sequence that is a proteolytic fragment of the erythrocyte membrane protein band 3. It has been shown to be able to inhibit the activity of cytosolic calcium and actin filament polymerization, as well as inhibiting apoptosis in human polymorphonuclear leukocytes (PMNL). This compound has been found to be effective in preventing uptake of bacteria by neutrophils, which may be due to its ability to alter the pH gradient across the membrane and increase intracellular calcium levels. For-Nle-Leu-Phe-Nle-Tyr-Lys-OH also inhibits diacylglycerol synthesis, which may contribute to its antiinflammatory effects.</p>Formula:C43H65N7O9Purity:Min. 95%Molecular weight:824.02 g/molNeuropeptide W-30 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide W-30 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H249N49O37SPurity:Min. 95%Molecular weight:3,543.12 g/molAc-muramyl-D-Ala-D-Glu-NH2
CAS:<p>Please enquire for more information about Ac-muramyl-D-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H32N4O11Purity:Min. 95%Molecular weight:492.48 g/molN-Methyl-N-boc-aminopropan-3-ol
CAS:<p>N-Methyl-N-boc-aminopropan-3-ol is a fine chemical with CAS No. 98642-44-5 that is used in the synthesis of complex compounds, as a reagent for research chemicals, and as a speciality chemical. It is also used in the synthesis of versatile building blocks, reaction components and scaffolds. N-Methyl-N-boc-aminopropan-3-ol has a high quality and can be used as a versatile intermediate or a useful scaffold.</p>Formula:C9H19NO3Purity:Min. 95%Color and Shape:Colourless To Pale Yellow LiquidMolecular weight:189.25 g/molH-Gln-Gly-Pro-OH·TFA
CAS:<p>Please enquire for more information about H-Gln-Gly-Pro-OH·TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H20N4O5·C2HF3O2Purity:Min. 95%Molecular weight:414.33 g/molStresscopin-Related Peptide (human)
CAS:<p>Please enquire for more information about Stresscopin-Related Peptide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C205H358N68O57Purity:Min. 95%Molecular weight:4,687.46 g/molZ-Ala-Phe-OMe
CAS:<p>Z-Ala-Phe-OMe is a model amide that has been used to study the serine protease catalysed hydrolysis of peptides. This compound is a water molecule analogue that is immobilized on an ion exchange resin, which can be used as a support for experiments in catalysis and thermodynamics. Z-Ala-Phe-OMe has shown to be more efficient than other substrates and can be used to study kinetic data and thermodynamic properties.</p>Formula:C21H24N2O5Purity:Min. 95%Molecular weight:384.43 g/mol(His(1-Me)2)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (His(1-Me)2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H77N17O13Purity:Min. 95%Molecular weight:1,196.32 g/molH-Met-Thr-OH
CAS:<p>Met-Thr-OH is a peptide binding inhibitor that is used as a research tool for determining the role of metalloproteins in vivo. Methionine aminopeptidase (MetAP) is an enzyme that cleaves methionine from protein and peptides and has been shown to play a vital role in cancer progression. MetAP has been shown to be inhibited by Met-Thr-OH, which binds to the enzyme's active site and blocks its activity. The inhibition of MetAP limits the production of proteins involved in cell growth and proliferation, leading to reductions in tumor size. This inhibition may also be due to the inhibition of other functional groups such as phosphorylation, dephosphorylation, or nitrosylation.</p>Formula:C9H18N2O4SPurity:Min. 95%Molecular weight:250.32 g/molToxic Shock Syndrome Toxin-1 (TSST-1) (58-78)
CAS:<p>Please enquire for more information about Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H171N33O35Purity:Min. 95%Molecular weight:2,371.61 g/molZ-D-Phe-Pro-OH
CAS:<p>D-Phe-Pro-OH is a tripeptide that is reversibly inactivated by methanol, chloromethyl ketone, and boronate esters. It can be used as an affinity label for the detection of aldehydes. This compound has been shown to be an inhibitor of protein synthesis and cell growth. It has also been used to synthesize analogs with similar properties, such as Z-D-Phe-Pro-OH.</p>Formula:C22H24N2O5Purity:Min. 95%Molecular weight:396.44 g/molMethyltetrazine amine
CAS:<p>A building block used for derivatization of carboxylic acids or activated esters with methytetrazine moiety. The stability of Methyltetrazine Amine is substantially improved compared to hydrogen substituted tetrazine-tmine. Superior stability of methyltetrazine-amine allows this reagent to be used in wider range of chemical transformations. Long-term storage of methyltetrazine-amine, especially in aqueous buffer, is also greatly improved compared to Tetrazine Amine.Supplied as the HCl salt</p>Formula:C10H11N5Purity:Min. 95%Color and Shape:PowderMolecular weight:201.23 g/molTIP-39 trifluoroacetate salt
CAS:<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C202H325N61O54SPurity:Min. 95%Molecular weight:4,504.19 g/molPAR-2 (6-1) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/molHTLV-1 Tax (11-19) trifluoroacetate salt
CAS:<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N9O12Purity:Min. 95%Molecular weight:1,070.28 g/mol(R)-4-N-Boc-2-hydroxymethyl-piperazine
CAS:<p>Please enquire for more information about (R)-4-N-Boc-2-hydroxymethyl-piperazine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O3Purity:Min. 95%Molecular weight:216.28 g/mol(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H162N30O30Purity:Min. 95%Molecular weight:2,348.62 g/molLHRH (7-10)·2 HCl
CAS:<p>Please enquire for more information about LHRH (7-10)·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H36N8O4·2HClPurity:Min. 95%Molecular weight:513.46 g/molAcetyl-(D-Val13)-α-MSH (11-13)
CAS:<p>Please enquire for more information about Acetyl-(D-Val13)-alpha-MSH (11-13) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H33N5O4Purity:Min. 95%Molecular weight:383.49 g/molMCH (salmon) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C89H139N27O24S4Purity:Min. 95%Molecular weight:2,099.49 g/molPerisulfakinin
CAS:<p>Perisulfakinin (PSK) is a cyclic peptide that has been isolated from the venom of the fly Phera insolita. PSK has a high affinity for protease activity and can be used as an inhibitor of proteases in control experiments. PSK is also an activator of cation channels and may be used as a neurotransmitter or neuromodulator in insects. The PSK peptide is present in dipteran species and can be seen by electron microscopy in their abdominal ganglia. PSK also activates Ca2+ influx into cells, which can lead to cell death. The PSK peptide is converted to cleavage products by enzymes, with bioassays being one way to measure these products.</p>Formula:C64H86N18O22S2Purity:Min. 95%Molecular weight:1,523.61 g/molFmoc-Tyr(Et)-OH
CAS:<p>Please enquire for more information about Fmoc-Tyr(Et)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H25NO5Purity:Min. 95%Molecular weight:431.48 g/mol(D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C196H288N56O56SPurity:Min. 95%Molecular weight:4,356.79 g/molPolyphemusin II-Derived Peptide
CAS:<p>Polyphemusin II-derived peptide H-Arg-Arg-2-Nal-Cys-Tyr-Arg-Lys-D-Lys-Pro-Tyr-Arg-Cit (PIIH) is a cyclic polypeptide with a disulfide bond. PIIH binds to the alpha4beta1 integrin receptor, which is involved in the adhesion of leukocytes to endothelial cells and the migration of monocytes and lymphocytes. PIIH has been shown to be a potent inhibitor of chemokine binding to cxcr4, an important regulator of inflammatory response in mouse tumor models. PIIH also inhibits hiv infection as it inhibits the release of virus from infected cells. This pharmacological effect is mediated by its ability to bind HIV gp120 and block gp120 binding to CD4 receptors on target cells.</p>Formula:C90H141N33O18S2Purity:Min. 95%Molecular weight:2,037.43 g/mol(D-Trp6)-LHRH (1-6) amide
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH (1-6) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H49N11O9Purity:Min. 95%Molecular weight:887.94 g/mol2,4-Dihydroxy-5-methylbenzoic acid
CAS:<p>2,4-Dihydroxy-5-methylbenzoic acid is a high quality chemical that can be used as a reagent, intermediate, or building block. It has many uses in the production of fine chemicals and research chemicals. 2,4-Dihydroxy-5-methylbenzoic acid is also a versatile building block for organic synthesis reactions. This compound has shown to have anti-inflammatory properties and may be useful as a treatment for arthritis.</p>Formula:C8H8O4Purity:Min. 95%Color and Shape:PowderMolecular weight:168.15 g/mol1-Boc-1-methylhydrazine
CAS:<p>1-Boc-1-methylhydrazine is a molecule that is used as a chemical intermediate for pharmaceuticals. It has been shown to inhibit the proteasome pathway by targeting the ubiquitin-proteasome system, which is involved in protein degradation and cell growth regulation. 1-Boc-1-methylhydrazine has synergistic effects when combined with other inhibitors of the ubiquitin proteasome system, such as anamorelin. It was found to be effective at inhibiting the growth of k562 cells but not normal cells, suggesting that it may have therapeutic applications for inflammatory bowel disease.</p>Formula:C6H14N2O2Purity:Min. 95%Molecular weight:146.19 g/mol5-(2-Methyl-4-nitrophenyl)-2-furaldehyde
CAS:<p>Please enquire for more information about 5-(2-Methyl-4-nitrophenyl)-2-furaldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H9NO4Purity:Min. 95%Molecular weight:231.2 g/molH-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt
CAS:<p>H-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt is a polyvalent antivenom that is used in the treatment of snakebites and insect stings. It has been shown to be effective in the treatment of life-threatening envenomations, including bites from cobras and other rattlesnakes. This drug is not active against nonactivated venom, such as those from bees or spiders. H-D-Pro-Phe-Arg-chloromethylketone trifluoroacetate salt binds to the cytolysin, which prevents its activity by inactivating it. The drug also has a vasoconstrictive effect, which limits blood flow to tissues and may reduce tissue damage caused by venom toxins.</p>Formula:C21H31ClN6O3Purity:Min. 95%Molecular weight:450.96 g/mol(Phe4)-Dermorphin (1-4) amide
CAS:<p>Dermorphin is a peptide that is derived from the proenkephalin gene. It is an opioid analgesic and has been shown to be effective in the treatment of hernias. Dermorphin has also been shown to inhibit platelet aggregation and blood coagulation, making it an antithrombotic therapy. The structure of dermorphin has been determined using a hydroxy group as the reactive site for synthesis and molecular modelling techniques. Dermorphin has also been shown to have an active oxygen species selectivity index (a measure of antioxidant activity) higher than those of other drugs in its class, which makes it suitable for use as a sealant in abdominal surgery.</p>Formula:C30H35N5O5Purity:Min. 95%Molecular weight:545.63 g/mol3-Amino-2-methoxy-dibenzofuran
CAS:<p>3-Amino-2-methoxy-dibenzofuran (3AMD) is a cytotoxic agent that is used in the treatment of bladder carcinoma. 3AMD inhibits DNA synthesis, leading to cell death by inhibiting the production of proteins vital for cell division. 3AMD has been shown to be a potent inhibitor of cyclen-dependent kinases and to induce DNA damage in human cells. 3AMD also has significant cytotoxicity against malignant cells and has been shown to inhibit the growth of tumours in mice. 3AMD may have carcinogenic potential due to its structural similarity with other carcinogens such as aniline and aminobiphenyl.</p>Purity:Min. 95%Molecular weight:213.23 g/molCyclo(-D-His-Pro)
CAS:<p>Please enquire for more information about Cyclo(-D-His-Pro) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H14N4O2Purity:Min. 95%Molecular weight:234.25 g/molPeptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Peptide YY (13-36) (canine, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H209N41O38Purity:Min. 95%Molecular weight:3,014.36 g/mol(D-Ser4,D-Trp6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ser4,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molH-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
CAS:<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Leu31,Pro34)-Neuropeptide Y (13-36) (human, rat)
CAS:<p>Please enquire for more information about (Leu31,Pro34)-Neuropeptide Y (13-36) (human, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C134H206N39O35SPurity:Min. 95%Molecular weight:2,955.38 g/molDABCYL-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-EDANS trifluoroacetate salt
CAS:Controlled Product<p>DABCYL-gamma-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr (DABCYL) is a fluorescent substrate that has been used to study the kinetics of peptide hydrolysis by proteases. It is an amino acid sequence that is present in angiotensinogen, which is a blood protein involved in regulating blood pressure. The DABCYL group on the terminal amino acid of the peptide provides a highly fluorescent molecule that can be excited at wavelengths longer than 400 nm. This fluorophore can also be used as a donor for fluorescence resonance energy transfer (FRET) with other fluorophores, such as EDANS, which has been shown to have high affinity for DABCYL. DABCYL can be used to measure enzyme activity or inhibition and has been found to be sensitive enough to detect changes due to dilutions at concentrations as low as 10 nM.</p>Formula:C90H120N22O16SPurity:Min. 95%Molecular weight:1,798.12 g/molNeuroendocrine Regulatory Peptide-2 (human) trifluoroacetate salt
<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H288N56O57Purity:Min. 95%Molecular weight:4,064.48 g/molCys-Gly-Lys-Lys-Gly-Amyloid b-Protein (36-42) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (36-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H86N14O13SPurity:Min. 95%Molecular weight:1,087.34 g/molH-Ala-His-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Ala-His-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H19N5O4Purity:Min. 95%Molecular weight:297.31 g/molH-Lys-Thr-Tyr-OH
CAS:<p>Please enquire for more information about H-Lys-Thr-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H30N4O6Purity:Min. 95%Molecular weight:410.46 g/molZ-Gly-His-OH
CAS:<p>Please enquire for more information about Z-Gly-His-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H18N4O5Purity:Min. 95%Molecular weight:346.34 g/molH1-7 acetate salt
CAS:<p>H1-7 acetate salt H-Arg-Arg-Lys-Ala-Ser-Gly-Pro-OH acetate salt is a synthetic, ternary complex of the amino acid histidine, arginine and lysine. It has been shown to inhibit β lactamase enzymes that are responsible for the hydrolysis of penicillin, cephalosporin, and monobactam antibiotics. The inhibition is due to the hydrophobic nature of the substrate binding site on β lactamase. This binding prevents the enzyme from hydrolyzing its substrate and inactivates it. In addition, H1-7 acetate salt H-Arg-Arg-Lys-Ala-Ser-Gly-Pro-OH acetate salt binds to calcium ions and has been shown to have a kinetic effect on β lactamases.</p>Formula:C31H58N14O9Purity:Min. 95%Molecular weight:770.88 g/molBoc-cys(Npys)-oh
CAS:<p>Boc-cys(Npys)-oh is an active substance that inhibits the growth of mouse tumors and has been shown to inhibit a number of different biological processes. It is a cross-linking agent for amino acids and has been shown to have an inhibitory effect on the synthesis of proteins by blocking the formation of disulfide bonds. This compound belongs to the class of chemicals known as sulfonamides, which are used in the treatment of bacterial infections. Boc-cys(Npys)-oh also specifically binds to antigen sites on cells, inhibiting their growth, and can be used as an antitumor agent. The molecule can be chemically linked with other molecules such as trifluoroacetic acid (TFA), resulting in a product with different properties than those found in Boc-cys(Npys)-oh. The chemical ligation process is used to produce subcutaneous tumors in mice that are then treated with hydrogen fluoride (</p>Formula:C13H17N3O6S2Purity:Min. 95%Color and Shape:Off-White PowderMolecular weight:375.42 g/molGuanylin (human)
CAS:<p>Please enquire for more information about Guanylin (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H87N15O21S4Purity:Min. 95%Molecular weight:1,458.66 g/molH-Leu-Leu-Leu-Phe-OMe·HCl
CAS:<p>Please enquire for more information about H-Leu-Leu-Leu-Phe-OMe·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H46N4O5·HClPurity:Min. 95%Molecular weight:555.15 g/molZ-Gly-Gly-Gly-Gly-Gly-Gly-OH
CAS:<p>Please enquire for more information about Z-Gly-Gly-Gly-Gly-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H26N6O9Purity:Min. 95%Molecular weight:494.46 g/molH-Gly-Gly-Pro-Ala-OH
CAS:<p>Glycosaminoglycans are polysaccharides that are made of repeating disaccharide units composed of a sugar and a uronic acid. Glycosaminoglycans serve as structural components in the extracellular matrix, where they provide tensile strength and elasticity to tissues. They also function as enzymes, providing energy for cellular processes. This glycosaminoglycan is found in human tissue, specifically the cervix and blood group antigens. It has been shown to have an effect on creatine kinase activity, which can be used as a screening tool for women who have had hysterectomies or biopsies done.</p>Formula:C12H20N4O5Purity:Min. 95%Molecular weight:300.31 g/molFmoc-Ile-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Ile-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Endothelin-3 (human, mouse, rabbit, rat) acetate
CAS:<p>Acetate salt</p>Formula:C121H168N26O33S4•(C2H4O2)xPurity:Min. 95%Molecular weight:2,643.05 g/molBoc-D-Ala-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-D-Ala-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Galanin (1-19) (human)
CAS:<p>Please enquire for more information about Galanin (1-19) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C89H130N26O25Purity:Min. 95%Molecular weight:1,964.14 g/molAc-Gln-NH2
CAS:<p>Ac-Gln-NH2 is a multifunctional protein that has been covalently immobilized on the surface of a glass fiber. It can be used to immobilize enzymes and other proteins, as well as being able to function as an enzyme itself. Ac-Gln-NH2 has been shown to conjugate with various molecules, including antibodies, DNA, and proteins. The immobilizing process involves cross-linking the protein to the glass surface through a chemical method that uses reagents such as glutaraldehyde or epoxy resin. Immobilization of Ac-Gln-NH2 onto a glass surface allows for easier use in applications such as diagnostics and industrial processes.</p>Formula:C7H13N3O3Purity:Min. 95%Molecular weight:187.2 g/molH-Phe-Pro-bNA·HCl
CAS:<p>Please enquire for more information about H-Phe-Pro-bNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H25N3O2·HClPurity:Min. 95%Molecular weight:423.93 g/mol
