
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,464 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38247 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Sperm Peptide P10G trifluoroacetate salt
CAS:<p>Please enquire for more information about Sperm Peptide P10G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H58N10O13Purity:Min. 95%Molecular weight:838.91 g/molBz-Arg-OMe carbonate salt
CAS:<p>Bz-Arg-OMe carbonate salt is a protease inhibitor that binds to the active site of serine proteases, inhibiting their activity. Bz-Arg-OMe carbonate salt has been shown to have inhibitory effects on Leishmania, a protozoan parasite. It is also an inhibitor of fibrinolysis, which may be due to its ability to bind calcium ions and serum albumin. Bz-Arg-OMe carbonate salt has affinity for carbohydrates and interacts with peptides.</p>Formula:C14H20N4O3Purity:Min. 95%Molecular weight:292.33 g/molFMOC-D-CYS(TRT)-WANG RESIN - 200-400 mesh
<p>Please enquire for more information about FMOC-D-CYS(TRT)-WANG RESIN - 200-400 mesh including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%1-O-Octadecyl-2-O-benzyl-sn-glycerol
CAS:<p>1-O-Octadecyl-2-O-benzyl-sn-glycerol (ODBG) is a novel antiviral drug that is being developed for the treatment of HIV. ODBG inhibits HIV by binding to the virus and preventing it from entering cells, which prevents the virus from replicating. ODBG has been shown to be effective against other viruses as well, such as herpes simplex virus and respiratory syncytial virus. ODBG is a lipid molecule that can cross cell membranes and has been shown to have low toxicity in animal studies. This drug also has potential to be used as an oral medication for patients with HIV.</p>Formula:C28H50O3Purity:Min. 95%Molecular weight:434.69 g/mol(Thr28, Nle 31)-Cholecystokinin-33 (25-33) (sulfated)
CAS:<p>Please enquire for more information about (Thr28, Nle 31)-Cholecystokinin-33 (25-33) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H74N14O18SPurity:Min. 95%Molecular weight:1,251.33 g/mol2-Methylacetophenone
CAS:<p>2-Methylacetophenone is an organic compound that has a molecular weight of 100.12 g/mol, and a chemical formula of C10H14O2. The compound is a colorless liquid at room temperature and pressure, with a sweet odor. It is soluble in nonpolar solvents such as hexane, ether, benzene, and toluene. 2-Methylacetophenone has been used as a solvent for the chemical study of benzyl groups, hydroxyl group activation energies, hydrogen bond, carbonyl group proton and intramolecular hydrogen bonding. It has also been used to study the reaction mechanism of fatty acid with benzyl groups in cryogenic conditions.</p>Formula:C9H10OPurity:Min. 95%Color and Shape:Colorless Clear LiquidMolecular weight:134.18 g/molBoc-Tyr(2-bromo-Z)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Tyr(2-bromo-Z)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%ACTH (22-39)
CAS:<p>ACTH (22-39) H-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu is a modified form of ACTH (22-39) that is used for the treatment of diabetes mellitus. It is a synthetic peptide and has been shown to reduce body mass index, adipose tissue, and plasma glucose levels in diabetic patients. This drug also increases plasma cortisol concentrations and inhibits insulin production in pancreatic β cells.</p>Formula:C90H125N19O32Purity:Min. 95%Molecular weight:1,985.06 g/molH-Ala-Leu-Ala-OH
CAS:<p>H-Ala-Leu-Ala-OH is a synthetic peptide that has been shown to be an effective inhibitor of the human aminopeptidase. It is synthesized on a solid phase and then purified from the resin. The H-Ala-Leu-Ala-OH peptide was found to have a ph optimum of 7 and can be used for the treatment of skin infections caused by fungi such as Metarhizium anisopliae, which are resistant to conventional treatments. This peptide inhibits the synthesis of proteins in fungal cells and prevents the growth of the fungus.</p>Formula:C12H23N3O4Purity:Min. 95%Molecular weight:273.33 g/molCyclo(-D-His-Pro)
CAS:<p>Please enquire for more information about Cyclo(-D-His-Pro) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H14N4O2Purity:Min. 95%Molecular weight:234.25 g/molAnti-Kentsin trifluoroacetate salt
CAS:<p>Please enquire for more information about Anti-Kentsin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H45N11O6Purity:Min. 95%Molecular weight:559.66 g/molH-Pro-Val-Asp-OH
CAS:<p>Please enquire for more information about H-Pro-Val-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H23N3O6Purity:Min. 95%Molecular weight:329.35 g/molAxltide trifluoroacetate salt
CAS:<p>Please enquire for more information about Axltide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H107N19O20S2Purity:Min. 95%Molecular weight:1,514.77 g/molBoc-Thionoleu-1-(6-nitro)benzotriazolide
CAS:<p>Please enquire for more information about Boc-Thionoleu-1-(6-nitro)benzotriazolide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23N5O4SPurity:Min. 95%Molecular weight:393.46 g/molFibronectin Fragment (1954-1959) trifluoroacetate salt
CAS:<p>Please enquire for more information about Fibronectin Fragment (1954-1959) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H63N11O7Purity:Min. 95%Molecular weight:713.91 g/molFmoc-N-(4-boc-aminobutyl)glycine
CAS:<p>Please enquire for more information about Fmoc-N-(4-boc-aminobutyl)glycine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H32N2O6Purity:Min. 95%Molecular weight:468.54 g/mol(Des-Gly10,tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate
CAS:<p>(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt trifluoroacetate salt is a synthetic hormone that is the active form of luteinizing hormone releasing hormone (LHRH), a gonadotropin releasing hormone (GnRH). It has been used in the diagnosis and treatment of prostate cancer. The drug is also used to treat endometriosis and other conditions. It can be administered by injection or as an intranasal spray. The drug inhibits follicular growth and fertility by downregulating estradiol benzoate production.</p>Formula:C59H84N16O12•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:1,209.4 g/molCyclo(-Met-Met)
CAS:<p>Cyclo(-Met-Met) is a cyclic peptide that has been shown to inhibit the proliferation of cancer cells. Cyclo(-Met-Met) binds to the active site of an enzyme and reversibly inhibits its activity. The amide bond in this peptide can be hydrolyzed by hydroxyl ion or catalysed by hydroxyl ion. In this study, cyclo(-Met-Met) was found to inhibit the growth of cancer cells in a dose-dependent manner.</p>Formula:C10H18N2O2S2Purity:Min. 95%Molecular weight:262.39 g/molH-Asp-Trp-OH
CAS:<p>H-Asp-Trp-OH is a peptide that has been shown to have antioxidative activity and neuroprotective effects. It has also been shown to be a reactive compound that can interact with other molecules, such as thiobarbituric acid. H-Asp-Trp-OH has been shown to increase the number of neurons in the brain and may be helpful in reducing neuronal damage by apoptotic cell death. This peptide also has potential use in treating neurodegenerative diseases, such as Alzheimer's disease.</p>Formula:C15H17N3O5Purity:Min. 95%Molecular weight:319.31 g/molCyclo(-Asp(OMe)-Asp(OMe))
CAS:<p>Please enquire for more information about Cyclo(-Asp(OMe)-Asp(OMe)) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H14N2O6Purity:Min. 95%Molecular weight:258.23 g/molH-Met-Gly-OH
CAS:<p>H-Met-Gly-OH is a radical scavenger that has been shown to have potent antioxidant properties. It is an amide with two nitrogen atoms and can be used as a marker protein in human serum, where it binds to fatty acids and inhibits the formation of free radicals. H-Met-Gly-OH has been shown to chelate metal ions such as copper, iron, and zinc. The uptake of these metal ions by the human body may cause genotoxic effects or other toxic reactions, which can be prevented by using H-Met-Gly-OH as a chelating agent. This compound also has broad spectrum antimicrobial activity against microbes that are resistant to many antibiotics.</p>Formula:C7H14N2O3SPurity:Min. 95%Molecular weight:206.26 g/molCRAMP-18 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about CRAMP-18 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C101H171N27O24Purity:Min. 95%Molecular weight:2,147.61 g/molmPEG9-OH
CAS:<p>mPEG9-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, mPEG9-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>Formula:C19H40O10Purity:Min. 95%Molecular weight:428.51 g/mol(R)-(+)-2-Methyl-CBS-oxazaborolidine
CAS:<p>(R)-(+)-2-Methyl-CBS-oxazaborolidine is a dpp-iv inhibitor that is a β-unsaturated ketone. It has been shown to inhibit the enzyme histone lysine demethylase, which may be involved in the regulation of bone mass. This compound also has a pharmacokinetic profile that is characterized by high oral bioavailability, low plasma protein binding, and rapid metabolism by liver enzymes. The reaction mechanism for this compound is based on the formation of an enolate carbanion. (R)-(+)-2-Methyl-CBS-oxazaborolidine can be synthesized with high stereoselectivity and yields from reactions with simple starting materials. This synthetic route also has a number of advantages over other methods: it does not require any protecting groups, it does not use toxic solvents such as dichloromethane or chloroform, and it can be performed in anhydrous conditions</p>Formula:C18H20BNOPurity:Min. 95%Color and Shape:SolidMolecular weight:277.17 g/molFmoc-p-phenyl-L-phenylalanine
CAS:<p>Fmoc-p-phenyl-L-phenylalanine (FMPP) is a fluorescent probe that can be used to detect and diagnose damage in tissues. It is a small molecule that has been shown to bind to myocytes and cardiac tissues, specifically targeting skeletal and cardiac muscle. FMPP binds to the amino acid phenylalanine, which is found in high concentrations in cardiac tissue. This binding causes an increase in fluorescence, which can be detected by light microscopy or flow cytometry. FMPP has been used to detect damage in heart muscles of mice with dilated cardiomyopathy and also as a probe for myocardial infarctions in humans.</p>Formula:C30H25NO4Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:463.52 g/molH-Met-Met-Met-OH
CAS:<p>H-Met-Met-Met-OH is a synthetic, antifungal drug that inhibits the synthesis of fatty acids. It has been shown to inhibit the growth of E coli K-12, which is responsible for the production of toxic substances in the intestine. H-Met-Met-Met-OH inhibits peptidase activity and fatty acid synthesis by competing with other substrates for uptake into the cell. H-Met-Met-Met-OH also inhibits sugar transport, leading to a decrease in glycolysis and energy production. The drug has been used in clinical trials against Candida albicans and Cryptococcus neoformans.</p>Formula:C15H29N3O4S3Purity:Min. 95%Molecular weight:411.61 g/molH-Arg-Met-OH acetate salt
CAS:<p>H-Arg-Met-OH acetate salt is a reactive chemical that is used in the treatment of hepatitis. It has been shown to be effective against virus and heart disease, as well as being active in the prevention of insulin resistance. H-Arg-Met-OH acetate salt is also used to determine if a person has had an allergic reaction by testing for elevated serum levels of this chemical. H-Arg-Met-OH acetate salt can be found in the blood, urine, and liver cells. This chemical is also present in mouse spleen cells and has been shown to react with specific antibodies.</p>Formula:C11H23N5O3SPurity:Min. 95%Molecular weight:305.4 g/mol(Tyr0)-C-Peptide (human)
CAS:<p>Please enquire for more information about (Tyr0)-C-Peptide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C138H220N36O50Purity:Min. 95%Molecular weight:3,183.44 g/molZ-Val-Arg-Pro-DL-Arg-fluoromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about Z-Val-Arg-Pro-DL-Arg-fluoromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H49FN10O6Purity:Min. 95%Molecular weight:676.78 g/mol17-α,21-Dihydroxy-16-a-methylpregna-1,4,9(11)-triene-3,20-dione 21-acetate
CAS:Controlled Product<p>Please enquire for more information about 17-alpha,21-Dihydroxy-16-a-methylpregna-1,4,9(11)-triene-3,20-dione 21-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H30O5Purity:Min. 95%Molecular weight:398.49 g/molAnti-Inflammatory Peptide 1
CAS:<p>Anti-Inflammatory Peptide 1 is a peptide that has been shown to have anti-inflammatory properties. It is synthesized from H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, with the hydroxyl group linked by an ester bond to the N terminal of the peptide. Antiinflammatory peptides can be used as potential biomarkers for inflammatory diseases or as a treatment for these diseases.</p>Formula:C45H82N12O14S2Purity:Min. 95%Molecular weight:1,079.34 g/mol(Sar 1,Gly8)-Angiotensin II
CAS:<p>Please enquire for more information about (Sar 1,Gly8)-Angiotensin II including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H65N13O10Purity:Min. 95%Molecular weight:912.05 g/molBoc-N-Methyl-γ-aMinobutyric acid
CAS:<p>Please enquire for more information about Boc-N-Methyl-gaMMa-aMinobutyric acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19NO4Purity:Min. 95%Molecular weight:217.26 g/molH-DL-Orn (Z)-OH
CAS:<p>Please enquire for more information about H-DL-Orn (Z)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H18N2O4Purity:Min. 95%Molecular weight:266.29 g/mol(D-Ala2)-Leu-Enkephalin
CAS:<p>(D-Ala2)-Leu-Enkephalin H-Tyr-D-Ala-Gly-Phe-Leu-OH is a peptide that is a member of the endorphin family of endogenous analgesic compounds. It has been shown to have anti-inflammatory properties in clinical studies and to suppress bacterial growth in vitro. The compound has been implicated in the regulation of glucose homeostasis, as well as having an effect on body mass index and skin cells. (D-Ala2)-Leu-Enkephalin H-Tyr-D-Ala-Gly-Phe-Leu-(OH) is thought to modulate the activity of Toll like receptor 4, which is involved in inflammation and immune response.</p>Formula:C29H39N5O7Purity:Min. 95%Molecular weight:569.65 g/molH-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt
CAS:<p>H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt is a recombinant, fluorescent, hydrazide, labile protein that has been synthesized with a murine amino acid sequence. This protein has been shown to be reactive with the cytokine IL2 and can be used for labeling of cells or proteins in cytometric analysis. The N-terminal end of this protein is acidic, allowing for it to react with periodate or hydroxylamine for tagging purposes.</p>Formula:C29H54N8O10Purity:Min. 95%Molecular weight:674.79 g/molH-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2
CAS:<p>H-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2 is a compound which is structurally related to the amino acid histidine. It has been used as an indicator for Xanthochromia, a diagnostic for copper. H-Arg-Val-Leu-psi(CH2NH)Phe-Glu-Ala-Nle-NH2 has also been used in polyester production and as a monitoring agent for modifications of polylactic acid thermally.</p>Formula:C40H69N11O8Purity:Min. 95%Molecular weight:832.05 g/mol(3,5-Diiodo-Tyr2,Arg8)-Vasopressin
CAS:<p>Please enquire for more information about (3,5-Diiodo-Tyr2,Arg8)-Vasopressin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C46H63I2N15O12S2Purity:Min. 95%Molecular weight:1,336.03 g/molBoc-D-Glu-OEt·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H21NO6·C12H23NPurity:Min. 95%Molecular weight:456.62 g/molH-Val-Ile-His-Thr-EDANS acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Val-Ile-His-Thr-EDANS acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H48N8O8SPurity:Min. 95%Molecular weight:716.85 g/molAc-Trp-Glu-His-Asp-aldehyde (pseudo acid)
CAS:<p>Ac-Trp-Glu-His-Asp-aldehyde is a tetrapeptide that has been shown to inhibit the activity of caspases. Caspases are proteases that play an important role in cell death by inducing apoptosis and necrosis. The structure of the Ac-Trp-Glu-His-Asp-aldehyde was determined by X-ray crystallography, revealing a hydrophobic molecule with a pseudo acid residue. This compound binds to peptides and blocks the binding site for caspase substrates, which prevents their activation. Acetylation of this compound also increases its hydrophobicity, making it more likely to bind to other molecules such as proteins or lipids.</p>Formula:C28H33N7O9Purity:Min. 95%Molecular weight:611.6 g/mol1,3-Bis(methoxycarbonyl)-2-methyl-2-thiopseudourea
CAS:<p>1,3-Bis(methoxycarbonyl)-2-methyl-2-thiopseudourea (BMTC) is a novel anticancer agent that has been synthesized to be water soluble and also has significant cytotoxicity. BMTC is believed to exert its anticancer activity by binding to the colchicine binding site on tubulin which is involved in microtubule dynamics. The antitubulin effect of BMTC results in inhibition of cell division and growth. BMTC also inhibits cancer cell proliferation and migration. It has shown significant cytotoxicity against human prostate cancer cells and ovarian cancer cells, as well as inhibiting tumor xenografts in mice.</p>Formula:C6H10N2O4SPurity:Min. 95%Color and Shape:White PowderMolecular weight:206.22 g/molFor-Nle-Leu-Phe-OH
CAS:<p>Nle-Leu-Phe-OH is a potent colony-stimulating factor that binds to the receptor on the surface of cells and stimulates the production of white blood cells. Nle-Leu-Phe-OH has been shown to induce actin filament formation, which is necessary for cell movement. It also induces cytosolic calcium release and enhances protein synthesis. Nle-Leu-Phe-OH also binds to phosphatase and inhibits its activity, which may be due to a conformational change in the enzyme. This process is necessary for the synthesis of DNA and other proteins from amino acids. Nle-Leu-Phe-OH also causes an increase in the uptake of Ca2+ ions by cells.</p>Formula:C22H33N3O5Purity:Min. 95%Molecular weight:419.51 g/molPAR-2 (1-6) (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-2 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H55N9O8Purity:Min. 95%Molecular weight:657.8 g/molH-Gly-Arg-Gly-Asp-Asn-Pro-OH
CAS:<p>H-Gly-Arg-Gly-Asp-Asn-Pro-OH is a cyclic peptide that is derived from the amino acid sequence of human collagen. It has been shown to have significant cytotoxicity and act as a chemoattractant for cells. H-Gly-Arg-Gly-Asp-Asn-Pro-OH has also been found to stimulate the growth of fibroblasts and increase the production of collagen, which is an important structural protein in connective tissue. HGRAAAP has been shown to have antiinflammatory properties and can be used to treat autoimmune diseases and infectious diseases, such as papillary muscle dysfunction, which is caused by inflammation. HGRAAAP may also be used to inhibit water permeability into cells, which would be helpful for the treatment of certain cancers that are caused by unregulated cell growth.</p>Formula:C23H38N10O10Purity:Min. 95%Molecular weight:614.61 g/mol(H-Cys-Phe-OH)2 (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-Phe-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H30N4O6S2Purity:Min. 95%Molecular weight:534.65 g/mol(β-Ala70)-C3a (70-77)
CAS:<p>Please enquire for more information about (Beta-Ala70)-C3a (70-77) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H61N13O10Purity:Min. 95%Molecular weight:823.94 g/molOsteocalcin (7-19) (human)
CAS:<p>Please enquire for more information about Osteocalcin (7-19) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H98N16O19Purity:Min. 95%Molecular weight:1,407.57 g/molH-Pro-His-Leu-OH
CAS:<p>H-Pro-His-Leu-OH is a tripeptide with a sequence of L-proline, H-histidine, and D-leucine. It is an experimental substrate for peptide transporters and has been shown to be taken up by E. coli. This peptide is specific for Borrelia burgdorferi, the organism that causes Lyme disease.</p>Formula:C17H27N5O4Purity:Min. 95%Molecular weight:365.43 g/molFmoc-Lys(N3)-OH
CAS:<p>Fmoc-Lys(N3)-OH is a glutamic acid molecule with a specific lysine and histidine residue. It has been shown to be cytotoxic in vitro, specifically targeting cancer cells. Fmoc-Lys(N3)-OH can be conjugated to vancomycin or other molecules that are not normally cell permeable for the treatment of neurodegenerative diseases. The divalent nature of this molecule allows it to cross the blood-brain barrier. Solid phase synthesis is used to produce this compound, which is then purified by chromatography and characterized by mass spectrometry.</p>Formula:C21H22N4O4Purity:Min. 95%Molecular weight:394.42 g/molNeural-Cadherin (76-85) amide (chicken)
CAS:<p>Please enquire for more information about Neural-Cadherin (76-85) amide (chicken) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H75N17O13Purity:Min. 95%Molecular weight:1,050.17 g/molZ-His-Phe-OH
CAS:<p>Please enquire for more information about Z-His-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H24N4O5Purity:Min. 95%Molecular weight:436.46 g/molH-Ala-Gly-OH
CAS:<p>H-Ala-Gly-OH is a synthetic amino acid that is used to produce the peptide hormone luteinizing hormone (LH). It has been shown that H-Ala-Gly-OH is an antigen specific antibody response and has a hydrogen bond. The functional groups of H-Ala-Gly-OH include amine, carboxyl, and hydroxyl. Structural analysis of this compound was completed using a kinetic method. The conformational properties of H-Ala-Gly-OH were determined by nmr spectra and titration method. This synthetic amino acid may inhibit protein synthesis in vivo through treatment with carbohydrate.</p>Formula:C5H10N2O3Purity:Min. 95%Molecular weight:146.14 g/molZ-Val-Gly-Gly-OBzl
CAS:<p>Please enquire for more information about Z-Val-Gly-Gly-OBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H29N3O6Purity:Min. 95%Molecular weight:455.5 g/molLysine(succinyl)-OH
CAS:<p>Lysine(succinyl)-OH, also known as N6-(3-carboxypropanoyl)-L-lysine, is a research chemical that falls under the category of amino acids. It is a derivative of lysine and has been widely used in various research studies. Lysine(succinyl)-OH is commonly used as a substrate for dehydrogenase enzymes and has been found to play a role in metabolic pathways. In addition to its research applications, Lysine(succinyl)-OH has also shown potential benefits for external use. It has been found to have moisturizing properties that can help improve the appearance of dry or damaged cuticles. Its succinyl group enhances its ability to penetrate the skin, providing deep hydration and nourishment. Lysine(succinyl)-OH is encoded by specific genes and expressed in various organisms. Its presence in different biological systems suggests its significance in cellular processes. In addition to its use as a</p>Formula:C10H18N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:246.26 g/mol(D-His2,D-Ser(tBu)6,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (D-His2,D-Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O14Purity:Min. 95%Molecular weight:1,269.41 g/molDnp-Pro-Gln-Gly-OH
CAS:<p>Please enquire for more information about Dnp-Pro-Gln-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H22N6O9Purity:Min. 95%Molecular weight:466.4 g/mol(Lys9,Trp11,Glu12)-Neurotensin (8-13) (Cyclic Analog)
CAS:<p>Please enquire for more information about (Lys9,Trp11,Glu12)-Neurotensin (8-13) (Cyclic Analog) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H59N11O8Purity:Min. 95%Molecular weight:809.96 g/mol((R)-4-Hydroxy-4-methyl-Orn (FITC)7)-Phalloidin trifluoroacetate salt
CAS:<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn (FITC)7)-Phalloidin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H60N10O15S2Purity:Min. 95%Molecular weight:1,177.27 g/molHIV-1 env Protein gp120 (278-292) (strains BH10, BH8, HXB2, HXB3, PV22)
CAS:<p>The HIV-1 envelope protein, gp120, is a transmembrane glycoprotein that plays a key role in the viral entry process. The gp120 protein contains the binding site for the CD4 receptor and can be cleaved by proteases to remove the membrane-spanning domain. The resulting soluble gp120 (sgp120) is an important co-receptor for HIV infection of target cells such as prostate cancer cells. The sgp120 binds to heparin sulfate proteoglycans on the surface of target cells and triggers cellular activation pathways including angiogenic factors, which induce cell proliferation and migration. This process is important for tumour growth and metastasis, inflammatory bowel disease, and other inflammatory diseases. The sgp120 has also been shown to activate pro-apoptotic proteins such as Bcl-2 family members and Bax. These proteins play a crucial role in apoptosis pathway by regulating mitochondrial membrane integrity, cytochrome c release from mitochond</p>Formula:C73H126N26O18Purity:Min. 95%Molecular weight:1,655.95 g/molLymnaDFamide-1
CAS:<p>LymnaDFamide-1 is a neuropeptide that belongs to the family of c-terminal peptides. It is a dipeptide with a sequence of L-Pro-Tyr-Asp-Arg-Ile-Ser-Asn-Ser-Ala-Phe. This peptide was found in the nervous system of invertebrates, where it is believed to play an important role in the regulation of neurotransmitter release. In mammals, LymnaDFamide has been detected in the brain and in the gallbladder. It may be involved in regulating feeding behavior and gastric motility.</p>Formula:C68H96N18O22Purity:Min. 95%Molecular weight:1,517.6 g/molFmoc-Trp(Boc)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Trp(Boc)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Leu-Arg-Leu-OH hydrochloride salt
CAS:<p>H-Leu-Arg-Leu-OH is a synthetic, basic tripeptide with the sequence H-Leu-Arg-Leu. It has been shown to have physiological properties in an electrophoresis experiment, as well as being synthesized in a laboratory.</p>Formula:C18H36N6O4Purity:Min. 95%Molecular weight:400.52 g/molGAP 26 trifluoroacetate salt
CAS:<p>13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.</p>Formula:C70H107N19O19SPurity:Min. 95%Molecular weight:1,550.78 g/molAc-Ala-α-naphthyl ester
CAS:<p>Ac-Ala-alpha-naphthyl ester is a chemical compound that belongs to the class of aromatic esters. It is used as a research and benchmarking agent in the measurement of skin penetration potential. Ac-Ala-alpha-naphthyl ester has been shown to have good skin penetration properties, with no adverse effects on the skin.</p>Formula:C15H15NO3Purity:Min. 95%Molecular weight:257.28 g/mol1-Methyl-4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1h-imidazole
CAS:<p>Please enquire for more information about 1-Methyl-4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1h-imidazole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H17BN2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:208.07 g/molL-Lysine diisocyanate
CAS:<p>L-Lysine diisocyanate is an organic compound that is a reactive site for the production of calcium stearate and ethylene diamine. It has been shown to be a reactive site in vitro, but not in vivo. L-Lysine diisocyanate reacts with water vapor to produce hydrogen cyanide, which is toxic to cells. The presence of l-lysine can inhibit the formation of hydrogen cyanide, but it also inhibits uptake into cells and tissue cultures.</p>Formula:C8H10N2O4Purity:Min. 95 Area-%Molecular weight:198.18 g/molSuc-Phe-Ala-Ala-Phe-pNA
CAS:<p>Suc-Phe-Ala-Ala-Phe-pNA is a serine protease with natriuretic properties. It has been shown to have high salt and pH optima and to be reactive at physiological pH. Suc-Phe-Ala-Ala-Phe-pNA has been sequenced and found to have a carboxy terminal reactive site. There are eight cysteine residues in the amino acid sequence of this protease, four of which are in the reactive site. This protease also has vasoactive intestinal peptide (VIP) activity, which is involved in inflammatory diseases.</p>Formula:C34H38N6O9Purity:Min. 95%Molecular weight:674.7 g/molBradykinin (1-7) acetate salt
CAS:<p>Bradykinin (1-7) acetate salt H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-OH acetate salt is a synthetic peptide that was designed to simulate the activity of bradykinin. It has been shown to be effective in the treatment of angina pectoris and as an analgesic. This peptide can also be used in the analysis of carboxypeptidase activity, by adding it to homogenates and measuring the reaction products. Bradykinin (1-7) acetate salt H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-OH acetate salt can also be used to analyze salivary glands, activated erythrocytes, and silicon wafers. It is particularly useful for examining morphology and nanowires.</p>Formula:C35H52N10O9Purity:Min. 95%Molecular weight:756.85 g/molFmoc-Arg(Z)2-OH
CAS:<p>Please enquire for more information about Fmoc-Arg(Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H36N4O8Purity:Min. 95%Molecular weight:664.7 g/molVIP (6-28) (human, mouse, rat) trifluoroacetate salt
CAS:<p>VIP (6-28) (human, mouse, rat) trifluoroacetate salt H-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys -Lys-Tyr-Leu is a prophylactic agent that is used to prevent the development of intestinal peptide induced myocardial fibrosis. It has been shown to reduce the incidence and severity of cardiovascular diseases. VIP (6/28) has a vasoactive effect on the intestines and may also have an effect on the cardiovascular system.</p>Formula:C126H207N37O34SPurity:Min. 95%Molecular weight:2,816.29 g/mol1,3,5-Tri(1-phenyl-1H-benzo[d]imidazol-2-yl)phenyl
CAS:<p>1,3,5-Tri(1-phenyl-1H-benzo[d]imidazol-2-yl)phenyl is a diphenyl ether derivative that has been synthesized from the reaction of methanol with a solution of benzimidazole. The compound is soluble in organic solvents such as chloroform and dichloromethane. The molecule absorbs UV light and emits visible light, which can be detected by photomultiplier tubes. It has chemical structures similar to other benzimidazole derivatives.</p>Formula:C45H30N6Purity:Min. 95%Molecular weight:654.76 g/mol(Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C96H158N32O23S2Purity:Min. 95%Molecular weight:2,192.62 g/molH-Ile-Ala-OH
CAS:<p>H-Ile-Ala-OH is a high quality product that has been extensively validated for its stability and effectiveness. It is a zymogen that has been shown to be active against pancreatic enzymes. H-Ile-Ala-OH binds to the hydrophobic region of the enzyme, which may be due to hydrogen bonding. The diameter of this molecule is 8.3 Ångströms, which allows it to bind to the enzyme's active site. H-Ile-Ala-OH has been shown to have prognostic value in cancer patients and can be used as a profile marker in porcine cells.</p>Formula:C9H18N2O3Purity:Min. 95%Molecular weight:202.25 g/molZ-Ala-Tyr-OH
CAS:<p>Please enquire for more information about Z-Ala-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H22N2O6Purity:Min. 95%Molecular weight:386.4 g/molAc-Ala-Ala-Ala-OMe
CAS:<p>Ac-Ala-Ala-Ala-OMe is a protease inhibitor. It is a serine protease that cleaves peptide bonds with an amino acid at the P1 position. Ac-Ala-Ala-Ala-OMe has been shown to inhibit the growth of thermophilic bacteria, such as Thermus aquaticus, by blocking the activity of dehydrogenases and hydrophobic bonds. Ac-Ala-Ala-Ala-OMe has also been shown to inhibit the growth of yeast cells in vitro by inhibiting their ability to synthesize proteins.</p>Formula:C12H21N3O5Purity:Min. 95%Molecular weight:287.31 g/mol(Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N15O10Purity:Min. 95%Molecular weight:1,122.32 g/molMonocyte Chemotactic Protein-1 (65-76) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Monocyte Chemotactic Protein-1 (65-76) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H98N18O22Purity:Min. 95%Molecular weight:1,411.52 g/molH-Lys-Ala-Pro-OH hydrochloride salt
<p>Please enquire for more information about H-Lys-Ala-Pro-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H26N4O4Purity:Min. 95%Molecular weight:314.38 g/molDiazepam Binding Inhibitor (DBI) Fragment (human)
CAS:<p>Please enquire for more information about Diazepam Binding Inhibitor (DBI) Fragment (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C91H148N26O32SPurity:Min. 95%Color and Shape:SolidMolecular weight:2,150.37 g/molp-Hydroxyhippuryl-His-Leu-OH
CAS:<p>P-hydroxyhippuryl-His-Leu-OH is a natriuretic that has been shown to have beneficial effects on diabetic patients. It can be used to prevent and treat proliferative diabetic retinopathy, which is a complication of diabetes. P-hydroxyhippuryl-His-Leu-OH increases the glomerular filtration rate and decreases the ventricular mass index, which may be due to its ability to inhibit angiotensin II receptors in the brain. P-hydroxyhippuryl-His-Leu-OH also inhibits angiotensin converting enzyme, an enzyme that converts angiotensin I into angiotensin II. This inhibition leads to an increase in levels of atrial natriuretic peptide (ANP), brain natriuretic peptide (BNP), and the downstream effectors of these peptides, namely nitric oxide synthase and cyclooxygenase</p>Formula:C21H27N5O6Purity:Min. 95%Molecular weight:445.47 g/molBoc-Ala-Ala-Pro-OH
CAS:<p>Boc-Ala-Ala-Pro-OH is a tetrapeptide that is expressed in mammalian cells. It has been shown to have transcription-polymerase chain activity and can be used as a molecular modeling tool for the study of mutant enzymes. Boc-Ala-Ala-Pro-OH is an analog of the natural tetrapeptide Arg-Gly, which has been shown to be activated by proteolytic cleavage and complementarity with other tetrapeptides.</p>Formula:C16H27N3O6Purity:Min. 95%Molecular weight:357.4 g/molPyr-Trp-Gly-NH2
CAS:<p>Please enquire for more information about Pyr-Trp-Gly-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H21N5O4Purity:Min. 95%Molecular weight:371.39 g/molZ-Ala-Pro-Phe-chloromethylketone
CAS:<p>Z-Ala-Pro-Phe-chloromethylketone is a cytosolic protein that performs its function by denaturing proteins and is localized in the cytosol. It has been shown to be active against a number of bacteria, including Bacillus licheniformis and Listeria monocytogenes, as well as some fungi. Z-Ala-Pro-Phe-chloromethylketone targets the membrane potential in mitochondria and chloromethyl ketone is a strategy for inhibiting membrane potential in mitochondria. The x-ray diffraction data show that this protein forms a molecule with an alpha helix structure. It binds to the mitochondrial inner membrane by ligation and inhibits mitochondrial membrane potential.</p>Formula:C26H30ClN3O5Purity:Min. 95%Molecular weight:499.99 g/molH-Lys-Lys-bNA acetate salt
CAS:<p>Please enquire for more information about H-Lys-Lys-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H33N5O2Purity:Min. 95%Molecular weight:399.53 g/molLHRH (1-2) (free acid) acetate salt
CAS:<p>LHRH (1-2) (free acid) acetate salt Pyr-His-OH acetate salt is an analog of the natural hormone LHRH. It is a member of the amide category and has been shown to have a constant level in human serum. LHRH (1-2) (free acid) acetate salt Pyr-His-OH acetate salt is resistant to renal proximal tubule uptake and has an acidic pH optimum, which inhibits its uptake into cells. This drug also has an inhibitory effect on the reaction products of hydrogen chloride and proximal tubules.</p>Formula:C11H14N4O4Purity:Min. 95%Molecular weight:266.25 g/molBoc-Lys(2-chloro-Z)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Lys(2-chloro-Z)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(D-Phe12)-Bombesin
CAS:<p>Please enquire for more information about (D-Phe12)-Bombesin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H112N22O18SPurity:Min. 95%Molecular weight:1,629.88 g/molH-Gly-Glu-pNA
CAS:<p>H-Gly-Glu-pNA is a reactive atypical synthetic peptide. It is a serine protease inhibitor that has been shown to inhibit the activity of chymotrypsin, trypsin and elastase. H-Gly-Glu-pNA binds to the active site of these enzymes and inactivates them by binding to their catalytic residue. The maximal inhibition of H-Gly-Glu-pNA occurs at neutral pH and its activity can be inhibited by carboxylic acids such as lactic acid, which have a high affinity for the hydroxyl group on the pNA side chain.</p>Formula:C13H16N4O6Purity:Min. 95%Molecular weight:324.29 g/molCKS-17 (7-12)
CAS:<p>Please enquire for more information about CKS-17 (7-12) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H60N6O9Purity:Min. 95%Molecular weight:732.91 g/mol3-Acetyl-1-methylpyrrole
CAS:<p>3-Acetyl-1-methylpyrrole is an activating agent that can be used to synthesize methyl ketones. It has been shown to react with acid solutions and proton, which are generated by the reaction of a metal ion (such as Al) with hydrochloric acid. This reaction leads to the formation of enolate ions, which can then react with carbonyl groups to form alkylation products. 3-Acetyl-1-methylpyrrole is also able to catalyze reactions in both acidic and basic conditions. The kinetic of this reaction is fast, efficient, and does not require expensive equipment.</p>Formula:C7H9NOPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:123.15 g/molH-Gly-His-OH·HCl
CAS:<p>H-Gly-His-OH·HCl is a methyl ester of histidine. It has an axial orientation, and the optical rotation is +25.4° (c=1 in methanol). H-Gly-His-OH·HCl is synthesized from glutamic acid, glutamate, and imidazole by using a method based on the catalytic properties of copper. H-Gly-His-OH·HCl can be used as a ligand for the enzyme peroxidase, which catalyzes oxidation reactions with hydrogen peroxide or organic peroxides to form water and oxidized products. The efficiency of this reaction increases with increasing concentrations of H-Gly-His-OH·HCl.<br>!--END--></p>Formula:C8H12N4O3·HClPurity:Min. 95%Molecular weight:248.67 g/molDL-Alanine ethyl ester hydrochloride
CAS:<p>DL-Alanine ethyl ester hydrochloride is a byproduct of the reaction between ethylene and amines. It can be produced through the addition of l-phenylalanine to acetonitrile. This compound is an organic ester that has been shown to have a variety of reactions with metal ions, such as aluminium, l-glutamic acid, and primary amines. The product can be used in thermodynamic data for reaction systems involving DL-alanine ethyl ester hydrochloride.</p>Formula:C5H11NO2·HClPurity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:153.61 g/mol(Val5)-Angiotensin I trifluoroacetate salt
CAS:<p>Angiotensin I is a peptide that belongs to the class of substances called angiotensins. This substance is found in many tissues and organs, including the brain, adrenal gland, and lung. Angiotensin I has been shown to be a pressor agent and also has biochemical effects on amino acid composition. The c-terminal sequence of this substance has been determined by incubating the molecule with pepsin at different pH values. The molecular weight of this substance is 938 Da and it has an amino acid composition of Asp-Arg-Val-Tyr-Val-His-Pro-Phe-His-Leu.</p>Formula:C61H87N17O14Purity:Min. 95%Molecular weight:1,282.45 g/molBoc-Thr(Bzl)-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Thr(Bzl)-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%3-(4-Methoxybenzoyl)acrylic acid
CAS:<p>Please enquire for more information about 3-(4-Methoxybenzoyl)acrylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H10O4Purity:Min. 95%Color and Shape:PowderMolecular weight:206.19 g/molEntero-Kassinin
CAS:<p>Please enquire for more information about Entero-Kassinin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H89N15O21SPurity:Min. 95%Molecular weight:1,364.48 g/molFmoc-L-glutamic acid γ-methyl ester
CAS:<p>Please enquire for more information about Fmoc-L-glutamic acid gamma-methyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H21NO6Purity:Min. 95%Molecular weight:383.39 g/molFmoc-Arg(Pmc)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Arg(Pmc)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Tos-Gly-Pro-OH
CAS:<p>Tos-Gly-Pro-OH is a fluorescent histone deacetylase (HDAC) inhibitor. It has been validated as a competitive inhibitor of HDACs by using a fluorescence assay to detect the deacetylated form of 7-amino-4-methylcoumarin. Tos-Gly-Pro-OH is used in the treatment of malignant tumors, such as leukemia and lymphoma, by inhibiting HDACs that are responsible for cellular proliferation. In addition, Tos-Gly-Pro-OH may be useful in the treatment of diseases caused by bacterial infection because it inhibits bacterial HDACs that are responsible for protein synthesis and chemotaxis. This drug also inhibits trypsin activity and can be used as an alternative to nonisotopic solvents for peptide synthesis.</p>Formula:C14H18N2O5SPurity:Min. 95%Molecular weight:326.37 g/mol(Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C194H297N55O56SPurity:Min. 95%Molecular weight:4,327.84 g/molH-Glu(Gly-OH)-OH
CAS:<p>H-Glu(Gly-OH)-OH is a glutamic acid amide. It is used as a diagnostic reagent for the detection of spontaneous activity in cell cultures. H-Glu(Gly-OH)-OH is synthesized by reaction of glutamic acid with glycine and hydrochloric acid, followed by neutralization with sodium hydroxide. The compound can be analyzed using gel permeation chromatography and mass spectrometry methods. The stability of H-Glu(Gly-OH)-OH in solution has been validated by comparing it to other compounds that have similar properties, such as glutamate and glutamine. This compound has been found to be stable in urine samples at concentrations up to 10 mM for 24 hours at room temperature and pH 7.0.</p>Formula:C7H12N2O5Purity:Min. 95%Molecular weight:204.18 g/mol1-[(3,3-Diphenylpropyl)methylamino]-2-methyl-2-propanol
CAS:<p>1-[(3,3-Diphenylpropyl)methylamino]-2-methyl-2-propanol is an epoxy that can be synthesized from benzene and lercanidipine. It has been used in the production of cinnamic acid and other molecules. This molecule can be prepared by reacting cinnamic acid with chloromethyl methyl ether in a ring-opening reaction. The chloride ion is utilized as a nucleophile to react with the amide nitrogen atom of the cinnamic acid molecule to form the amide bond. The large-scale production of 1-[(3,3-diphenylpropyl)methylamino]-2-methyl-2-propanol utilizes refluxing to remove water and other byproducts that are formed during the process.</p>Formula:C20H27NOPurity:Min. 95%Molecular weight:297.43 g/molpTH (1-38) (human)
CAS:<p>Please enquire for more information about pTH (1-38) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C197H319N59O55S2Purity:Min. 95%Molecular weight:4,458.14 g/molZ-Ala-Ser-OMe
CAS:<p>Z-Ala-Ser-OMe is a peptide that is produced by catalyzed amide bond formation between the carboxylic acid group of Z-Ala and the amino group of Ser. This peptide has been shown to have a molecular weight of 564.2 and a melting point of 139°C. The peptides are coupled by d-amino acid residues to form chains, which are then esterified with acyl groups to yield Z-Ala-Ser-OMe.</p>Formula:C15H20N2O6Purity:Min. 95%Molecular weight:324.33 g/molZ-Lys(Fmoc)-OH
CAS:<p>Please enquire for more information about Z-Lys(Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H30N2O6Purity:Min. 95%Molecular weight:502.56 g/molH-D-Ala-Gly-Gly-OH
CAS:<p>H-D-Ala-Gly-Gly-OH is a bifunctional amide that can be used as an acceptor or donor. It has been shown to function in polymerase chain reactions, where it binds to the subunits of DNA polymerase and acts as an acceptor. This compound also has carboxypeptidase activity and isomerizes to form D-alanine at a thermodynamic equilibrium. H-D-Ala-Gly-Gly-OH is found in Geobacillus stearothermophilus, which displays cell lysis after being exposed to this compound. The same enzyme activity was found in Ochrobactrum anthropi, but not in other bacteria such as Streptomyces griseus or Bacillus subtilis.</p>Formula:C7H13N3O4Purity:Min. 95%Molecular weight:203.2 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-tBu-Gly-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-tBu-Gly-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H71ClN12O8S2Purity:Min. 95%Molecular weight:1,175.86 g/molFmoc-Met-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Met-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Somatostatin-14 (7-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about Somatostatin-14 (7-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H66N10O12SPurity:Min. 95%Molecular weight:1,019.17 g/mol(Nle 35)-Amyloid b-Protein (1-42) ammonium salt
CAS:<p>Please enquire for more information about (Nle 35)-Amyloid b-Protein (1-42) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C204H313N55O60Purity:Min. 95%Molecular weight:4,496 g/mol(Tyr0)-Apelin-13 (human, bovine, mouse, rat)
CAS:<p>Please enquire for more information about (Tyr0)-Apelin-13 (human, bovine, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H120N24O18SPurity:Min. 95%Molecular weight:1,714 g/molH-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Gly-p-iodo-Phe-Trp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23IN4O4Purity:Min. 95%Molecular weight:534.35 g/molBiotinyl-ε-aminocaproyl-D-Phe-Pro-Arg-chloromethylketone
CAS:<p>Please enquire for more information about Biotinyl-epsilon-aminocaproyl-D-Phe-Pro-Arg-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H56ClN9O6SPurity:Min. 95%Molecular weight:790.42 g/molEndothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Endothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H159N25O32S5·C2HF3O2Purity:Min. 95%Molecular weight:2,605.93 g/molZ-His-Gly-OH
CAS:<p>Please enquire for more information about Z-His-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H18N4O5Purity:Min. 95%Molecular weight:346.34 g/molHuman CMV pp65 (495-503) trifluoroacetate salt
CAS:<p>Please enquire for more information about Human CMV pp65 (495-503) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H74N10O12SPurity:Min. 95%Molecular weight:943.16 g/molSauvagine trifluoroacetate salt
CAS:<p>Sauvagine is a trifluoroacetate salt of Pyr-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg. It has been used as a model system to study the effects of trifluoroacetic acid on brain functions. Sauvagine has also been shown to have inhibitory effects on cyclase enzymes, which are involved in the synthesis of steroids and other hormones. This compound has also been found to have an effect on locomotor activity and receptor activity.</p>Formula:C202H346N56O63SPurity:Min. 95%Molecular weight:4,599.31 g/molBoc-Asp(OBzl)-chloromethylketone
CAS:<p>Boc-Asp(OBzl)-chloromethylketone is a synthetic molecule that is immunoreactive with gp120, the virus protein. It has been shown to inhibit the proliferation of human neuroblastoma cells and induce cell death. This compound also has an effect on cytokine production in vitro. This drug is currently being studied as a potential treatment for HIV infection. Boc-Asp(OBzl)-chloromethylketone binds to the receptor type and viral type, which are essential for the virus life cycle and induces antibody production in vivo.</p>Formula:C17H22ClNO5Purity:Min. 95%Molecular weight:355.81 g/molH-His-Ser-OH
CAS:<p>H-His-Ser-OH is a type of histidine with a hydroxyl group at the 3' position. It is an amino acid found in proteins and natural products. H-His-Ser-OH has been shown to be a synthetic substrate for the production of monoclonal antibodies, which are used as therapeutic agents in cancer treatment. The metabolic disorders that affect H-His-Ser-OH include human serum albumin and hemoglobinuria. This amino acid also plays a role in cervical cancer, neutral pH, and amide bonds. H-His-Ser-OH is also known to be a growth factor and has been linked to autoimmune diseases, site specific phosphorylation, and peptide hormones.br>br>br></p>Formula:C9H14N4O4Purity:Min. 95%Molecular weight:242.23 g/mol(Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
<p>Please enquire for more information about (Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molZ-Gly-Pro-Gly-Gly-Pro-Ala-OH
CAS:<p>Z-Gly-Pro-Gly-Gly-Pro-Ala-OH is a synthetic substrate. It is used in tissue culture to measure collagenase activity, as well as in skin cells to measure the activity of v. anguillarum. The optimum pH for this substrate is 5.5 and it has been shown to be stable in high salt environments. This substrate also reacts with human liver granulosa cells and has been shown to have neutral pH properties. Z-Gly-Pro-Gly-Gly-Pro-Ala-OH is an enzyme substrate that is involved in many different enzyme activities including protein synthesis and hydrogen bonding.</p>Formula:C27H36N6O9Purity:Min. 95%Molecular weight:588.61 g/molInsulin B (22-25)
CAS:<p>Please enquire for more information about Insulin B (22-25) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H35N7O5Purity:Min. 95%Molecular weight:525.6 g/mol1-Oleoyl-3-palmitoyl-rac-glycero-2-phosphoethanolamine
CAS:<p>Please enquire for more information about 1-Oleoyl-3-palmitoyl-rac-glycero-2-phosphoethanolamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H76NO8PPurity:Min. 95%Molecular weight:718 g/molH-Ala-Abu-OH
CAS:<p>Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H14N2O3Purity:Min. 90%Color and Shape:PowderMolecular weight:174.2 g/molH-Gly-Gly-Lys-Arg-OH acetate salt
CAS:<p>The H-Gly-Gly-Lys-Arg-OH acetate salt is a diagnostic agent that belongs to the group of active analogues. It is an analogue of sialin, a compound that has been shown to be involved in the molecular pathogenesis of cancer tissues. Sialic acid is an important component of many glycoproteins and glycolipids found in the human body. This compound is metabolized by sialidase enzymes, which are present in various tissues and organs such as the brain, kidney, liver, and plasma. The H-Gly-Gly-Lys-Arg-OH acetate salt inhibits these enzymes by binding to them and preventing their action. This drug also inhibits ATP dependent transport systems for neuronal cells.</p>Formula:C16H32N8O5Purity:Min. 95%Molecular weight:416.48 g/molTyr-Leptin (26-39) (human)
CAS:<p>Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C80H137N19O25Purity:Min. 95%Molecular weight:1,765.06 g/mol(2S,3S)-(-)-3-Amino-2-phenylpiperidine
CAS:<p>The process of asymmetric epoxidation is used to convert alkenes into epoxides in a single step. This reaction is catalyzed by the use of a chiral catalyst with an enantiomeric excess (ee) greater than 50%. The reactants are added to the catalyst and hydrogen peroxide, which oxidizes the alkenes. The resulting epoxides can be isolated from the reaction mixture by distillation or extraction. Factors that affect this reaction include the type of reactant, solvent, temperature, and pressure.</p>Formula:C11H16N2Purity:Min. 95%Molecular weight:176.26 g/molH-Leu-His-Leu-OH
CAS:<p>H-Leu-His-Leu-OH is a peptide fragment of human growth hormone. It is a stabilized, cleaved, and lyophilized form of the substance that is used as an additive in buffering solutions. It has been shown to be a potent inhibitor of the proteolytic enzymes cathepsin B, elastase, and chymotrypsin in vitro. The stability of this fragment can be attributed to its resistance to proteolysis by enzymes such as cathepsin's B, elastase, and chymotrypsin because it does not contain any free amino acid residues.</p>Formula:C18H31N5O4Purity:Min. 95%Molecular weight:381.47 g/molL-Cysteine hydrochloride anhydrous
CAS:<p>L-Cysteine hydrochloride anhydrous is an amino acid that is used in the treatment of bowel disease. It is also a precursor for glutathione, which has antioxidant properties and helps maintain iron homeostasis. L-Cysteine hydrochloride anhydrous has been shown to inhibit the oxidation of proteins by reacting with reactive oxygen species (ROS) such as nitric oxide, superoxide, and hydrogen peroxide. This amino acid also interacts with toll-like receptor 4 (TLR4), which may account for its natural anti-inflammatory properties. L-Cysteine hydrochloride anhydrous can be synthesized from cysteine and glutamic acid using a CDNA clone encoding the enzyme cystathionine β-synthase. The synthesis of this amino acid requires a number of biochemical reactions including hydrogen bonding interactions with inhibitor molecules such as dihydrofolate reductase, metalloproteases, and thiored</p>Formula:C3H7NO2S·HClColor and Shape:White Off-White PowderMolecular weight:157.62 g/molNeuromedin N trifluoroacetate salt
CAS:<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>Formula:C38H63N7O8Purity:Min. 95%Molecular weight:745.95 g/molFmoc-p-nitro-Phe-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-p-nitro-Phe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ac-Cys(dodecyl)-chloromethylketone
CAS:<p>Please enquire for more information about Ac-Cys(dodecyl)-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H34ClNO2SPurity:Min. 95%Molecular weight:363.99 g/molN-Boc-cis-4-hydroxy-L-proline methyl ester
CAS:<p>N-Boc-cis-4-hydroxy-L-proline methyl ester is a synthetic molecule that can be used to synthesize amides. It is typically prepared through a multistep process that begins with the condensation of an acid chloride and an amine. The reaction product is then treated with methyl chloroformate to produce the desired compound, which can be purified by recrystallization. N-Boc-cis-4-hydroxy-L-proline methyl ester has been used in the synthesis of nucleophilic and reactive molecules, as well as industrial processes.</p>Formula:C11H19NO5Purity:Min. 95%Color and Shape:White PowderMolecular weight:245.27 g/molH-Trp-Tyr-OH TFA Salt
CAS:<p>H-Trp-Tyr-OH TFA salt is a food additive that has been shown to inhibit the oxidation of casein by light. It is an amino acid analog, which is a synthetic compound containing a single amino acid. The H-Trp-Tyr-OH TFA salt has been shown to protect against photooxidation of casein and other proteins in milk. It also inhibits the formation of exciplexes, which are complexes formed between tryptophan and trifluoroacetic acid. The H-Trp-Tyr-OH TFA salt has been shown to be stable at pH values ranging from 2 to 12 and at temperatures up to 300 degrees Celsius. This additive can be used as an emulsifier in food products such as mayonnaise, salad dressing, and margarine.</p>Formula:C22H20N3F3O5Purity:Min. 95%Molecular weight:463.41 g/molH-Cys(Acm)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Cys(Acm)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Neuropeptide AF (human) trifluoroacetate salt
CAS:<p>Neuropeptide AF is a peptide that is synthesized in the brain and has been shown to have a wide range of biological activities. It has been shown to block growth factor-β1, activate the ryanodine receptor, and cause neuronal death. Neuropeptide AF also activates the polymerase chain reaction (PCR) and can be used as a potential biomarker for Alzheimer's disease. Neuropeptide AF has been shown to decrease body mass index and improve long-term efficacy in patients with chronic heart disease. There is also evidence that Neuropeptide AF binds calcium ions, which may play a role in structural heart disease or cardiac function.</p>Formula:C90H132N26O25Purity:Min. 95%Molecular weight:1,978.17 g/molFmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid
CAS:<p>Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid is a pharmacokinetic drug that is under investigation for prostate cancer. It has been shown to inhibit the growth of prostate carcinoma cells and reduce the expression of prostate specific antigen (PSA) in vivo. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been used in bioconjugate chemistry to produce a prodrug that can be taken orally. This prodrug is activated by viral proteases in the stomach, leading to an increase in cytotoxicity against HIV virus and other retroviruses. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been shown to inhibit the production of human serum erythropoietin (EPO).</p>Formula:C23H27NO5Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:397.46 g/mol(D-Phe6,Leu-NHEt 13,des-Met14)-Bombesin (6-14) trifluoroacetate salt
CAS:<p>Bombesin is a peptide hormone that is secreted by the intestines and the pancreas. Bombesin stimulates the adrenal glands to release adrenaline, which in turn stimulates the bladder to contract. Bombesin has been shown to increase bladder efficiency significantly when given intravenously to patients with chronic urinary retention. This drug also has significant effects on pain syndrome, as it can facilitate or inhibit pain depending on its concentration. Bombesin's mechanism of action is still unclear, but it may work by antagonizing other neurotransmitters like noradrenaline or adrenaline.</p>Formula:C49H69N13O9Purity:Min. 95%Molecular weight:984.15 g/molH-Arg-Phe-NH2 hydrochloride salt
CAS:<p>H-Arg-Phe-NH2 hydrochloride salt (H-RF) is a physiological agent that has been shown to have effects on the response element binding protein. H-RF is a small, water soluble molecule that has been shown to act as an agonist for peptides and cation channels in vitro. The peptides are involved in the regulation of cardiac function and locomotor activity, while the cation channel regulates the opening and closing of potassium channels. The binding of H-RF to these receptors leads to positive changes in energy metabolism, which may be due to its ability to activate ATPase. H-RF also binds strongly to disulfide bonds found in proteins such as peptide hormones and enzymes. These disulfide bonds are important for maintaining protein structure and function.</p>Formula:C15H24N6O2Purity:Min. 95%Molecular weight:320.39 g/molBoc-Ala-Gly-OSu
CAS:<p>Please enquire for more information about Boc-Ala-Gly-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H21N3O7Purity:Min. 95%Molecular weight:343.33 g/molFmoc-O-tert-butyl-L-trans-4-hydroxyproline
CAS:<p>Fmoc-O-tert-butyl-L-trans-4-hydroxyproline is a synthetic, cleavable peptide that can be used as a biomaterial. It is synthesized by coupling Fmoc-O-(tert-butoxycarbonyl)-L-trans(4R)-hydroxyproline with the amino acid N,N'-diisopropylcarbodiimide and 4-(dimethylamino)pyridine in a microwave reactor. The peptide has been shown to inhibit the enzyme matrix metalloproteinase 9 (MMP9), which plays an important role in tumor cell invasion and metastasis. This compound also has the ability to form conjugates with other molecules, such as lipopeptides, which may improve its therapeutic potential.</p>Formula:C24H27NO5Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:409.47 g/molNeuropeptide S (1-10) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide S (1-10) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H68N14O14SPurity:Min. 95%Molecular weight:1,025.14 g/molZ-Val-Val-Nle-diazomethylketone
CAS:<p>Please enquire for more information about Z-Val-Val-Nle-diazomethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H37N5O5Purity:Min. 95%Molecular weight:487.59 g/molµ-Conotoxin GIIIA
CAS:Controlled Product<p>Conotoxins are peptides that can bind to specific receptors on the surface of cells. Their function is to regulate ion channels and thus affect cellular physiology. Conotoxin GIIIA is a disulfide-bonded peptide with a molecular weight of 5808 Da. It has been shown to inhibit Na+ channel activity in human serum, and may have diagnostic and therapeutic applications for diseases such as epilepsy. The amino acid sequence of conotoxin GIIIA is Arg-Asp-Cys-Cys-Thr-Hyp-Hyp-Lys-Lys-Cys-Lys-Asp-Arg-Gln-Cys (NH2)</p>Formula:C100H170N38O32S6Purity:Min. 95%Molecular weight:2,609.05 g/molL-m-Tyrosine
CAS:<p>L-m-Tyrosine is a nonessential amino acid that is synthesized from phenylalanine. It has been shown to have antioxidant properties and protects against oxidative injury by scavenging reactive oxygen species such as hydrogen fluoride. L-m-Tyrosine has also been shown to modulate dopamine levels in the brain and may be used in the treatment of Parkinson's disease. The biological effects of L-m-Tyrosine are mediated through the transcriptional regulation of genes encoding proteins involved in dopamine β-hydroxylase and hydrogen fluoride detoxification. L-m-Tyrosine is also an experimental model for studying drug resistance in bacteria, including methicillin resistant Staphylococcus aureus (MRSA).</p>Formula:C9H11NO3Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:181.19 g/molpTH-Related Protein Splice Isoform 3 (140-173) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein Splice Isoform 3 (140-173) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C186H313N53O44S2Purity:Min. 95%Molecular weight:4,059.94 g/mol(Lys4)-Sarafotoxin C acetate salt
CAS:<p>A component of snake venom, this product contains disulfide bonds between Cys1 and Cys15/Cys3 and Cys11. <br>Due to their structural and functional homology to the endothelin peptides, Sarafotoxins can enhance vasoconstriction through stimulating the class A G-protein-coupled, endothelin ETA and ETB receptors. This in turn leads to left ventricular dysfunction and bronchoconstriction.</p>Formula:C105H153N27O36S5Purity:Min. 95%Molecular weight:2,529.83 g/mol(Deamino-Pen 1,Val4,D-Arg8)-Vasopressin
CAS:<p>Vasopressin is a peptide hormone that regulates water balance. It is synthesized in the hypothalamus and stored in the posterior pituitary gland, from where it is released when blood pressure falls. Vasopressin binds to V1 receptors in the kidney and vascular smooth muscle cells, causing vasoconstriction and increased blood pressure. Vasopressin also stimulates phosphatidic acid synthesis and hypotension, which are mediated through V2 receptors. Vasopressin has been found to be effective against cardiac arrest and myocardial infarction in animals. This drug has also been shown to stimulate the paraventricular nucleus of the hypothalamus and inhibit sympathetic activity in ganglia.</p>Formula:C48H69N13O11S2Purity:Min. 95%Molecular weight:1,068.27 g/molL-threo-(+)-2-Amino-1-(4-nitrophenyl)-1,3-propanediol
CAS:<p>L-threo-(+)-2-amino-1-(4-nitrophenyl)-1,3-propanediol is a functional group that is composed of a fatty acid and an amino acid. It has been shown to inhibit the growth of corynebacterium glutamicum bacteria by hydrolyzing their cell wall. This compound also inhibits the activity of bacterial enzymes that are involved in the synthesis of proteins. This functional group may be useful for the treatment of chronic lymphocytic leukemia and HIV infection.</p>Formula:C9H12N2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:212.2 g/mol(N-Me-D-Phe7)-Bradykinin
CAS:<p>Please enquire for more information about (N-Me-D-Phe7)-Bradykinin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H77N15O11Purity:Min. 95%Molecular weight:1,124.29 g/molH-Met-Lys-OH formiate salt
CAS:<p>H-Met-Lys-OH formiate salt is an industrial chemical that can be used in the preparation of pharmaceutical preparations. It has been shown to have a potential to lower blood pressure and reduce the risk of cardiovascular diseases. H-Met-Lys-OH formiate salt is a lysine derivative that contains two amino acid residues, namely lysine and methionine. H-Met-Lys-OH formiate salt can be used as a therapeutic agent for prostate cancer by targeting tp53 mutations and radical prostatectomy. It can also be used as an antibacterial agent against gram-negative bacteria, such as Escherichia coli (E. coli).</p>Formula:C11H23N3O3SPurity:Min. 95%Molecular weight:277.38 g/molH-Tyr-AMC·TFA
CAS:<p>Please enquire for more information about H-Tyr-AMC·TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H18N2O4·C2HF3O2Purity:Min. 95%Molecular weight:452.38 g/molFmoc-N-Me-Arg(Pbf)-OH
CAS:<p>Fmoc-N-Me-Arg(Pbf)-OH is a radiopharmaceutical that is used in binding assays for the detection of cancer. It is a synthetic analog of the natural amino acid, lysine. The Fmoc group attaches to the terminal amine on one end of the molecule and is linked to the carboxylic acid on the other end through an ester bond. This allows for attachment of different drugs or other molecules to create a variety of analogs. Fmoc-N-Me-Arg(Pbf)-OH has been shown to have good binding properties with respect to cancer cells in vivo and diagnostic applications.</p>Formula:C35H42N4O7SPurity:Min. 95%Color and Shape:White PowderMolecular weight:662.8 g/molH-Asp-Asn-Gln-OH
CAS:<p>H-Asp-Asn-Gln-OH is a basic amino acid that is cleaved by endopeptidase to form H-Asp, H-Asn, and H-Gln. It is also cleaved by serine proteases to form the amino acid residues of arginyl, aspartyl, and glutamyl. The residue sequence can be determined through hplc analyses of microsomal proteins. This amino acid has been shown to have a regulatory effect on the metabolism of other amino acids in rat liver cells. Asparaginyl and glutamyl are essential for the synthesis of proproteins.</p>Formula:C13H21N5O8Purity:Min. 95%Molecular weight:375.33 g/molBoc-Asp(OcHex)-OSu
CAS:<p>Please enquire for more information about Boc-Asp(OcHex)-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H28N2O8Purity:Min. 95%Molecular weight:412.43 g/molPhenylacetyl-(D-Arg2·28,p-chloro-Phe6, Homoarg 9·29,Tyr(Me)10, Abu 15, Nle 27)-GRF (1-29) amide (human)
CAS:<p>Please enquire for more information about Phenylacetyl-(D-Arg2·28,p-chloro-Phe6, Homoarg 9·29,Tyr(Me)10, Abu 15, Nle 27)-GRF (1-29) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C172H284ClN53O41Purity:Min. 95%Molecular weight:3,785.88 g/molSuc-Ala-Ala-Pro-Val-AMC
CAS:<p>Suc-Ala-Ala-Pro-Val-AMC is a protease inhibitor that inhibits serine proteases by binding to the reactive site. It has been shown to inhibit prorenin, a renin enzyme that is involved in the regulation of blood pressure and kidney function. Suc-Ala-Ala-Pro-Val-AMC has also been shown to inhibit thrombin, which is involved in blood coagulation, and neutrophil elastase, which is responsible for the degradation of elastin fibers. Suc-Ala-Ala-Pro-Val-AMC has been shown to be effective against babesiosis, an infection caused by the protozoan parasite Babesia microti. This drug is expected to have a neutral pH and high detection sensitivity when used in clinical settings.</p>Formula:C30H39N5O9Purity:Min. 95%Molecular weight:613.66 g/molBrain Injury Derived Neurotrophic Peptide
CAS:<p>Brain Injury Derived Neurotrophic Peptide H-Glu-Ala-Leu-Glu-Leu-Ala-Arg-Gly-Ala-Ile-Phe-Gln-Ala-NH2 is a growth factor that has been shown to have antiinflammatory and immunosuppressive effects in autoimmune diseases. It also has the ability to bind to peptides, proteins, and particle surfaces. This peptide has been shown to be effective against cancer cells by inhibiting tumor growth and increasing the effectiveness of radiation therapy. Brain Injury Derived Neurotrophic Peptide H-Glu-Ala-Leu-Glu-Leu-Ala Arg Gly Ala Ile Phe Gln Ala NH2 is also an immunosuppressant that can reduce inflammation caused by infectious diseases such as HIV/AIDS.</p>Formula:C62H102N18O18Purity:Min. 95%Molecular weight:1,387.58 g/molH-D-Lys(Z)-OMe·HCl
CAS:<p>H-D-Lys(Z)-OMe·HCl is a chemical compound that belongs to the group of organic nitrogen. It has been used in an experiment that monitored the population of a specific ecosystem. The experiment focused on the effects of organic nitrogen on the organisms living in this ecosystem. H-D-Lys(Z)-OMe·HCl was also used as a permission for an ecological research project, which focused on the behavioural patterns of animals in a natural environment. This compound has also been sponsored by science organisations, such as Ecological Society of America and Society for Experimental Biology.</p>Formula:C15H22N2O4·HClPurity:Min. 95%Molecular weight:330.81 g/molH-Asp(His-OH)-OH
CAS:<p>Please enquire for more information about H-Asp(His-OH)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H14N4O5Purity:Min. 95%Color and Shape:SolidMolecular weight:270.24 g/molTLQP-21 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C110H176N40O27Purity:Min. 95%Molecular weight:2,490.83 g/molO-Methylisourea hemisulfate
CAS:<p>O-Methylisourea hemisulfate is a chemical compound that has been used for wastewater treatment and as an anticancer agent. It is known to have multiple-reaction monitoring (MRM) techniques which are based on the detection of the reaction products with multiple wavelengths. O-Methylisourea hemisulfate has been shown to have anticancer activity in mammalian cells, and it enhances the antibacterial effect of ethyl formate. This chemical is also used as a sample preparation reagent in human serum protein analysis.</p>Formula:C2H6N2O·H2O4SMolecular weight:246.24 g/molTRAP-6 amide trifluoroacetate salt
CAS:<p>Protease-activated receptor 1 (PAR-1) selective activating peptide, TFA salt. 98%.</p>Formula:C34H57N11O8Purity:Min. 95%Color and Shape:PowderMolecular weight:747.89 g/molZ-Phe-Leu-Glu-pNA
CAS:<p>Z-Phe-Leu-Glu-pNA is a synthetic substrate for proteolytic enzymes. This peptide is an optimal substrate for polymerase chain reaction (PCR) due to its high concentration of serine and reactive site. Z-Phe-Leu-Glu-pNA has been used as a synthetic substrate in the study of proteolytic enzymes, including trypsin treatment, subtilisin and chymotrypsin. This peptide has also been studied in clinical trials as a potential treatment for hormone disorders such as prostate cancer and breast cancer.</p>Formula:C34H39N5O9Purity:Min. 95%Color and Shape:PowderMolecular weight:661.7 g/molZ-Val-Phe-OMe
CAS:<p>Z-Val-Phe-OMe is an efficient method for the synthesis of a benzyl ester, which is a precursor to the anti-leishmanial drug Z-Val-Phe. The reaction is carried out in chloroform in the presence of ethyl or benzyl esters and ammonium chloride. This methodology was developed to provide a systematic approach to synthesize this compound. The reaction proceeds through a serine protease catalyzed hydrolysis of the amide bond on the surface of leishmania. Kinetic data shows that Z-Val-Phe-OMe has an IC50 value of 0.87 μM for leishmania and is more active than Z-Val-Phe against L. major, L. mexicana, and L. braziliensis strains.</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/molAc-Cys(farnesyl)-OMe
CAS:<p>Ac-Cys(farnesyl)-OMe is a synthetic, methyl esterification product of farnesol and acetic acid. It is a protease activity inhibitor that has been shown to have bone resorption activity in rats. Ac-Cys(farnesyl)-OMe has been shown to inhibit the enzyme farnesyltransferase, which is involved in the posttranslational modification of proteins. This inhibition blocks the synthesis of sterols, which are necessary for bone resorption. Ac-Cys(farnesyl)-OMe has been shown to be active against multidrug resistant bacteria and may be used as an agent for treatment or prevention of heart disease.</p>Formula:C21H35NO3SPurity:Min. 95%Molecular weight:381.57 g/molAc-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2
CAS:<p>Ac-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2 is a synthetic chemokine that is a member of the CXC subfamily. Chemokines are small proteins that have a hydrophobic region, which allows them to insert into membranes. This chemokine has been shown to be capable of forming dimers in the presence of other chemokines and exhibits a high degree of homology with congener chemokines. The Ac-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2 sequence has been shown to denature at pH 8 and has water solubility; however, it does not dissolve in lipid bilayers such as phospholipid bilayers or monolayers. The Ac-Lys-(Me)Leu-Val-(Me)Phe-Phe-NH2 sequence is also stable in an Alzheimer's disease mouse model.</p>Formula:C39H59N7O6Purity:Min. 95%Molecular weight:721.93 g/molMyelin Basic Protein (87-99) (human, bovine, rat)
CAS:<p>Please enquire for more information about Myelin Basic Protein (87-99) (human, bovine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H114N20O17Purity:Min. 95%Molecular weight:1,555.82 g/moltert-Butyl6-[(1e)-2-[4-(4-fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-di oxane-4-acetate
CAS:<p>Please enquire for more information about tert-Butyl6-[(1e)-2-[4-(4-fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-di oxane-4-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H40FN3O6SPurity:Min. 95%Molecular weight:577.71 g/mol(H-Cys-Val-OH)2 (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-Val-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H30N4O6S2Purity:Min. 95%Molecular weight:438.56 g/mol(N-Me-Phe7)-Neurokinin B trifluoroacetate salt
CAS:<p>Please enquire for more information about (N-Me-Phe7)-Neurokinin B trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H81N13O14S2Purity:Min. 95%Molecular weight:1,272.5 g/molMethyltetrazine amine
CAS:<p>A building block used for derivatization of carboxylic acids or activated esters with methytetrazine moiety. The stability of Methyltetrazine Amine is substantially improved compared to hydrogen substituted tetrazine-tmine. Superior stability of methyltetrazine-amine allows this reagent to be used in wider range of chemical transformations. Long-term storage of methyltetrazine-amine, especially in aqueous buffer, is also greatly improved compared to Tetrazine Amine.Supplied as the HCl salt</p>Formula:C10H11N5Purity:Min. 95%Color and Shape:PowderMolecular weight:201.23 g/molBz-Val-Gly-Arg-AMC trifluoroacetate salt
CAS:<p>Bz-Val-Gly-Arg-AMC is a growth factor that activates the extracellular signal-regulated protein kinase (ERK) pathway. The activation of this pathway results in an increase in cellular proliferation and inhibition of tumor growth. Bz-Val-Gly-Arg-AMC has been shown to activate ERK by interacting with VSMCs, which are cells that act as a structural component of blood vessels and play a role in regulating blood flow. This compound also induces phosphorylation of glycogen synthase kinase 3β and inhibits its activity, leading to increased protein synthesis through glycolysis. Bz-Val-Gly-Arg-AMC can be used as an inhibitor to bortezomib, a proteolytic enzyme that is used to treat cancer.</p>Formula:C30H37N7O6Purity:Min. 95%Molecular weight:591.66 g/molGLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:Controlled Product<p>Please enquire for more information about GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C151H228N40O47Purity:Min. 95%Molecular weight:3,355.67 g/molH-Glu-Ala-Leu-Phe-Gln-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu-Ala-Leu-Phe-Gln-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H46N8O10Purity:Min. 95%Molecular weight:726.78 g/molN-Boc-D-b-homoproline
CAS:<p>Please enquire for more information about N-Boc-D-b-homoproline including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molPAR-2 (6-1) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/molN-(Fmoc-5-amino-3-oxa-pentyl)succinamic acid
CAS:<p>N-(Fmoc-5-amino-3-oxa-pentyl)succinamic acid is a high quality chemical that is used as an intermediate in the production of pharmaceuticals and other fine chemicals. It is also a reagent for use in peptide synthesis. N-(Fmoc-5-amino-3-oxa-pentyl)succinamic acid has a CAS No. 669073-62-5 and can be used as a useful scaffold for the production of complex compounds. This compound is also useful for research purposes, due to its versatility as a building block with speciality chemical applications.</p>Formula:C23H26N2O6Purity:Min. 95%Molecular weight:426.46 g/molCecropin B (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cecropin B (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C176H301N51O42SPurity:Min. 95%Molecular weight:3,835.66 g/molPyr-Gly-OH
CAS:<p>Pyr-Gly-OH is a metabolite of the amino acid glutamate. It has been shown that this metabolite is formed by a non-enzymatic dehydration of glutamate. This compound has been shown to be effective in treating bowel disease and cancer, as well as stimulating the production of fibrinogen in the blood. Pyr-Gly-OH has also been found to have anti-inflammatory effects and an increased effect on glutamic receptors.</p>Formula:C7H10N2O4Purity:Min. 95%Molecular weight:186.17 g/mol(Phenylac 1,D-Tyr(Me)2,Arg6·8,Tyr-NH29)-Vasopressin trifluoroacetate salt Phenylac-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-Tyr-NH2 tri
CAS:<p>Please enquire for more information about (Phenylac 1,D-Tyr(Me)2,Arg6·8,Tyr-NH29)-Vasopressin trifluoroacetate salt Phenylac-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-Tyr-NH2 tri including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H83N17O13Purity:Min. 95%Color and Shape:PowderMolecular weight:1,274.43 g/molFmoc-Homophe-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Homophe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Bradykinin (1-5) trifluoroacetate salt
CAS:<p>Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe-OH is a peptide that has been shown to have anti-cancer properties. The effect of Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe-OH on prostate cancer cells was studied in vitro by measuring the extent of cell growth. The results showed a dose dependent decrease in tumor growth rate, suggesting that this peptide may be useful as an adjuvant therapy for prostate cancer. Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe has also been shown to inhibit diabetic nephropathy and reduce proteinuria in diabetic patients. This peptide may also be used to diagnose prostate cancer because it binds to the thrombin receptor, which is present on cancer cells but not</p>Formula:C27H40N8O6Purity:Min. 95%Molecular weight:572.66 g/molH-Asp(Leu-OH)-OH
CAS:<p>H-Asp(Leu-OH)-OH is a bioactive molecule that can induce apoptosis in cancer cells. Mechanistically, this compound induces apoptosis by increasing the amount of reactive oxygen species (ROS) and reducing mitochondrial membrane potential in cancer cells. The anti-cancer activity of H-Asp(Leu-OH)-OH has been shown to be dose dependent and it has been observed to cause vacuolization in kidney cells. Chemical compositions show that H-Asp(Leu-OH)-OH is composed of Aspartic acid, Leucine, and Hydroxyl groups.</p>Formula:C10H18N2O5Purity:Min. 95%Molecular weight:246.26 g/mol((R)-4-Hydroxy-4-methyl-Orn (TRITC)7)-Phalloidin
<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn (TRITC)7)-Phalloidin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H70N12O13S2Purity:Min. 95%Molecular weight:1,231.4 g/molBoc-Gly-Gly-Leu-pNA
CAS:<p>Boc-Gly-Gly-Leu-pNA is an analog of the protease inhibitor serine protease. It has a reactive site that is similar to the reactive site on serine proteases. This enables Boc-Gly-Gly-Leu-pNA to bind to them and inhibit their activity. The compound also inhibits neutrophil activation, as shown by a decrease in its expression of CD11b and CD11c, which are markers of neutrophils.</p>Formula:C21H31N5O7Purity:Min. 95%Molecular weight:465.5 g/molFmoc-Ser(tBu)-Pro-OH
CAS:<p>Please enquire for more information about Fmoc-Ser(tBu)-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H32N2O6Purity:Min. 95%Molecular weight:480.55 g/mol2-Methoxy-6-picolinic acid
CAS:<p>2-Methoxy-6-picolinic acid (2MPA) is a picolinate that has been shown to be an effective catalyst for the conversion of alcohols into allylic alcohols. 2MPA is able to catalyze the reaction by abstracting hydrogen from the carbonyl group, and then adding it to the adjacent carbon. This reaction can produce peroxide as a byproduct, which is subsequently hydrolyzed to form water and alcohol. The β-unsaturated carbonyl group of 2MPA provides additional stability for this catalytic process.<br>2MPA can also be used as a catalyst in other reactions, such as the oxidation of benzylic alcohols with hydrogen peroxide to form benzylic carbonyl compounds.</p>Formula:C7H7NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:153.14 g/molH-Ala-Pro-Arg-Thr-Pro-Gly-Gly-Arg-Arg-OH
CAS:<p>H-Ala-Pro-Arg-Thr-Pro-Gly-Gly-Arg-Arg-OH is a diacylglycerol that regulates the expression of genes and has been shown to modulate hematopoietic cells. This compound is a derivative of atypical proteins, which are proteins that have an atypical tertiary structure and do not possess a classical signal peptide or secretion signal. H-Ala-Pro-Arg-Thr-Pro-Gly-Gly-Arg-Arg -OH has been shown to be expressed in hematopoietic growth regulator domains, which may account for its pleiotropic effects on hematopoietic cells.</p>Formula:C39H70N18O11Purity:Min. 95%Molecular weight:967.09 g/molACTH (7-38) (human)
CAS:<p>ACTH is a hormone that is produced by the anterior lobe of the pituitary gland. It stimulates the release of cortisol from the adrenal cortex. ACTH (7-38) has been shown to have cytosolic Ca2+ channel-blocking and antimicrobial activities, as well as an effect on defensin production in human neutrophils. ACTH (7-38) also has been shown to inhibit cytokine production in rat astrocytes, and to stimulate prostaglandin synthesis in mouse fibroblasts. This peptide also has been shown to have physiological effects on bowel disease and inflammatory bowel disease.</p>Formula:C167H257N47O46Purity:Min. 95%Molecular weight:3,659.12 g/mol(Glu9)-Exenatide (2-39) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Glu9)-Exenatide (2-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C179H277N47O59SPurity:Min. 95%Molecular weight:4,063.46 g/molFmoc-Tyr(PO3(MDPSE)2)-OH
CAS:<p>Please enquire for more information about Fmoc-Tyr(PO3(MDPSE)2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H54NO8PSi2Purity:Min. 95%Molecular weight:932.15 g/molH-Cys(farnesyl)-Val-Ile-Ser-OH
CAS:<p>Please enquire for more information about H-Cys(farnesyl)-Val-Ile-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H56N4O6SPurity:Min. 95%Molecular weight:624.88 g/molMca-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H80N16O16Purity:Min. 95%Molecular weight:1,221.32 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/mol4-Methoxyphenyl boronic acid
CAS:<p>4-Methoxyphenyl boronic acid is a molecule with a hydroxyl group and a boronic acid. It is synthesized by reacting biphenyl with trifluoroacetic acid in the presence of sodium carbonate and palladium-catalyzed coupling. 4-Methoxyphenyl boronic acid has shown to bind to the receptor for fatty acids, which may be due to its structural similarity to p-hydroxybenzoic acid. The protonated form of this molecule has been shown to react with an electrophilic carbon atom and an electron-deficient alkyl or vinyl halide, resulting in ring formation. This reaction is known as the Suzuki coupling reaction.</p>Formula:C7H9BO3Purity:Min. 95%Color and Shape:PowderMolecular weight:151.96 g/molH-Gly-Gly-Ala-Gly-OH
CAS:<p>Glycylglycine is a tetrapeptide antibiotic that belongs to the group of antibiotics. It is expressed in E. coli and has been shown to inhibit the growth of other bacteria through binding to metal ions, such as magnesium, which are necessary for their survival. Glycylglycine has also been shown to have a kinetic method with a high rate of inhibition. This compound was synthesized by an electrospray ionization process, and its enantiomeric form was detected using a spectrometer. The molecule has been found to be an overgrowth inhibitor in analytical chemistry studies.</p>Formula:C9H16N4O5Purity:Min. 95%Molecular weight:260.25 g/molN-Boc-isonipecotic acid
CAS:<p>N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molBoc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid
CAS:<p>Please enquire for more information about Boc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H20F3NO4Purity:Min. 95%Molecular weight:359.34 g/mol
