
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,465 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38248 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
(D-His2)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-His2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H75N17O13Purity:Min. 95%Molecular weight:1,182.29 g/molH-Pro-Glu-OH
CAS:<p>H-Pro-Glu-OH is a homologous peptide that belongs to the group of proteins. It is synthesized in the cells by polymerase chain reaction and can be used for diagnosis of infectious diseases. It has been shown to induce antibody response in mice. H-Pro-Glu-OH is also active against Mycobacterium tuberculosis, which may be due to its ability to bind to the tyrosine kinase domain on protein genes. This peptide has been shown to have anti-inflammatory properties, inhibiting fatty acid production and leading to necrotic cell death.</p>Formula:C10H16N2O5Purity:Min. 95%Molecular weight:244.24 g/molH-Val-Val-Val-Val-OH
CAS:<p>Please enquire for more information about H-Val-Val-Val-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H38N4O5Purity:Min. 95%Molecular weight:414.54 g/molH-Thr-Gly-Gly-OH
CAS:<p>Please enquire for more information about H-Thr-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H15N3O5Purity:Min. 95%Molecular weight:233.22 g/molNeuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C87H135N25O24Purity:Min. 95%Molecular weight:1,915.16 g/molDynorphin A (1-7)
CAS:<p>Dynorphin A (1-7) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-OH is a peptide that acts as a cryoprotectant. It has been shown in animal models to inhibit the proliferation of cells in culture and to have neuroprotective properties. Dynorphin A (1-7) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-OH has also been shown to have antiinflammatory properties in animals, although the exact mechanism of action is not known. This peptide can be used as an excipient in pharmaceutical formulations or as a diluent for lyophilisates.</p>Formula:C40H61N13O9Purity:Min. 95%Molecular weight:867.99 g/molTos-Gly-Pro-Lys-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Tos-Gly-Pro-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H37N5O7SPurity:Min. 95%Molecular weight:611.71 g/molNeuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt
<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C175H290N56O59Purity:Min. 95%Molecular weight:4,122.52 g/molBoc-β-cyclopropyl-Ala-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-beta-cyclopropyl-Ala-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4·C12H23NPurity:Min. 95%Molecular weight:410.59 g/molGlutathione-monoethyl ester (reduced)
CAS:<p>Glutathione-monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH is a polymerase chain reaction (PCR) enhancer that consists of a glutathione monoester and an ethyl ester. Glutathione monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH is used as a cancer therapeutics agent in the treatment of cells with high levels of reactive oxygen species. It also inhibits drug efflux from cells and induces apoptosis in endothelial cells, which can lead to the inhibition of tumor growth. Glutathione monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH has been shown to cause changes in intracytoplasmic sperm and protein thiols in PC12 cells, which may be related to its ability to inhibit cell proliferation.</p>Formula:C12H21N3O6SPurity:Min. 95%Molecular weight:335.38 g/molH-Gly-Leu-Phe-OH
CAS:<p>H-Gly-Leu-Phe-OH is a peptide that has been isolated from human macrophages. The peptide is homologous to the amino acid sequence of casein and has shown anti-inflammatory properties in the inhibition of the enzymatic reaction between casein and sodium citrate. When incubated with polymorphonuclear leukocytes, H-Gly-Leu-Phe-OH showed an inhibitory effect on their growth. This peptide also inhibited the enzymatic reaction between casein and sodium citrate, which may be due to its reversed phase high performance liquid chromatography (RP HPLC) method.</p>Formula:C17H25N3O4Purity:Min. 95%Molecular weight:335.4 g/mol2-Phenylacetamide
CAS:Controlled Product<p>2-Phenylacetamide is a nitro, acetate extract that has been shown to have antimicrobial activity. It can inhibit HIV infection and has been investigated as an antiviral drug. 2-Phenylacetamide binds to the 2-adrenergic receptor, which is found in high concentrations in the brain and inhibits the release of neurotransmitters. It also binds to κ-opioid receptors and sodium carbonate, which are found on cells throughout the body. The biological properties of this substance have not been fully elucidated but some studies suggest that it may be able to inhibit microbial metabolism or stimulate monoamine neurotransmitters.</p>Formula:C8H9NOPurity:Min. 95%Color and Shape:White PowderMolecular weight:135.16 g/mol(D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H100N22O14S3Purity:Min. 95%Molecular weight:1,449.77 g/molFmoc-Mating Factor a TFA salt
CAS:<p>Please enquire for more information about Fmoc-Mating Factor a TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H124N20O19S(freebase)Purity:Min. 95%Molecular weight:1,906.21 g/molFmoc-b-Ala-Ala-Pro-OH
CAS:<p>Fmoc-b-Ala-Ala-Pro-OH is a reaction component that can be used in the synthesis of peptides and other compounds. It is a building block for the preparation of complex compounds, such as small molecules, polymers and natural products. Fmoc-b-Ala-Ala-Pro-OH has been shown to be useful in the synthesis of various types of reagents, including antibiotics and pharmaceuticals. This chemical has been reported as a useful scaffold for the preparation of high quality research chemicals. Fmoc-b-Ala-Ala-Pro is also an intermediate in the synthesis of speciality chemicals and fine chemicals.</p>Formula:C26H29N3O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:479.53 g/mol3-Amino-2-methoxy-dibenzofuran
CAS:<p>3-Amino-2-methoxy-dibenzofuran (3AMD) is a cytotoxic agent that is used in the treatment of bladder carcinoma. 3AMD inhibits DNA synthesis, leading to cell death by inhibiting the production of proteins vital for cell division. 3AMD has been shown to be a potent inhibitor of cyclen-dependent kinases and to induce DNA damage in human cells. 3AMD also has significant cytotoxicity against malignant cells and has been shown to inhibit the growth of tumours in mice. 3AMD may have carcinogenic potential due to its structural similarity with other carcinogens such as aniline and aminobiphenyl.</p>Purity:Min. 95%Molecular weight:213.23 g/molBoc-Gly-Phe-OBzl
CAS:<p>Please enquire for more information about Boc-Gly-Phe-OBzl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H28N2O5Purity:Min. 95%Molecular weight:412.48 g/molPolyphemusin II-Derived Peptide
CAS:<p>Polyphemusin II-derived peptide H-Arg-Arg-2-Nal-Cys-Tyr-Arg-Lys-D-Lys-Pro-Tyr-Arg-Cit (PIIH) is a cyclic polypeptide with a disulfide bond. PIIH binds to the alpha4beta1 integrin receptor, which is involved in the adhesion of leukocytes to endothelial cells and the migration of monocytes and lymphocytes. PIIH has been shown to be a potent inhibitor of chemokine binding to cxcr4, an important regulator of inflammatory response in mouse tumor models. PIIH also inhibits hiv infection as it inhibits the release of virus from infected cells. This pharmacological effect is mediated by its ability to bind HIV gp120 and block gp120 binding to CD4 receptors on target cells.</p>Formula:C90H141N33O18S2Purity:Min. 95%Molecular weight:2,037.43 g/molH-Arg-Arg-4MbetaNA·3 HCl
CAS:<p>Please enquire for more information about H-Arg-Arg-4MbetaNA·3 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H35N9O3·3HClPurity:Min. 95%Molecular weight:594.96 g/molAcetyl-ACTH (1-17) Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH
CAS:<p>Please enquire for more information about Acetyl-ACTH (1-17) Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H147N29O24SPurity:Min. 95%Molecular weight:2,135.45 g/molOsteostatin (human) trifluoroacetate salt
CAS:<p>Osteostatin is a recombinant human protein that inhibits bone growth by binding to and neutralizing the effect of forskolin. Osteostatin also has an inhibitory effect on cancer cells, as it inhibits mitochondrial pathways and prevents the activation of factor receptors. Osteostatin blocks the synthesis of cAMP, which is necessary for cell proliferation in cancer cells. The inhibition of cAMP levels leads to a decrease in the production of proteins that stimulate bone growth, such as runx2.</p>Formula:C142H228N42O58Purity:Min. 95%Molecular weight:3,451.58 g/molFmoc-D-His(1-Mtt)-OH
CAS:<p>Please enquire for more information about Fmoc-D-His(1-Mtt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H35N3O4Purity:Min. 95%Molecular weight:633.73 g/molH-D-Val-Leu-Arg-pNA·2 AcOH
CAS:<p>H-D-Val-Leu-Arg-pNA·2 AcOH is a kallikrein inhibitor that can be used as a blood pressure lowering agent. It inhibits the enzymatic activity of kallikrein, which is responsible for the conversion of kininogen to bradykinin, and thus prevents the production of natriuretic peptides. H-D-Val-Leu-Arg-pNA·2 AcOH has been shown to decrease blood pressure in animals by inhibiting filtration through the glomerulus and by blocking renin release from juxtaglomerular cells.</p>Formula:C23H38N8O5·2C2H4O2Purity:Min. 95%Molecular weight:626.7 g/molBoc-S-tert-butylthio-L-cysteine
CAS:<p>Boc-S-tert-butylthio-L-cysteine is a di-sulfide linked cysteine</p>Formula:C12H23NO4S2Purity:Min. 95%Molecular weight:309.45 g/molBoc-Lys(Fmoc)-Leu-Ala-Leu-OH
CAS:<p>Please enquire for more information about Boc-Lys(Fmoc)-Leu-Ala-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H59N5O9Purity:Min. 95%Molecular weight:765.94 g/molBoc-Arg(Tos)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Arg(Tos)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Succinyl-(Glu9,Ala11·15)-Endothelin-1 (8-21)
CAS:<p>Sovateltide is a peptide that is composed of 21 amino acids. It is an agonist of the endothelin receptors ET A and ET B. Succinyl-(Glu9,Ala11·15)-Endothelin (8,21) Sovateltide has been shown to be neuroprotective in preclinical studies and may have potential as a therapeutic agent for the treatment of radiation damage to the brain.</p>Formula:C86H117N17O27Purity:Min. 95%Molecular weight:1,820.95 g/molH-His-Leu-His-bNA acetate salt
CAS:<p>Please enquire for more information about H-His-Leu-His-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H34N8O3Purity:Min. 95%Molecular weight:530.62 g/molMitogenic Pentapeptide Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Ser-Asn-Ala-OH
CAS:<p>Mitogenic Pentapeptide Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Ser-Asn-Ala-OH is a synthetic pentapeptide that can be used to induce cell proliferation and antibody production. This peptide has been used in clinical trials with regulatory approval for use in humans. It has been shown to promote antibody response in animal experiments and to be active against tumor cells in tissue culture and cell cultures. Mitogenic Pentapeptide Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Ser-Asn-Ala-OH also activated the monoclonal antibodies produced by hybridoma cells.</p>Formula:C67H124N6O14SPurity:Min. 95%Molecular weight:1,269.8 g/molOsteocalcin (37-49) (human)
CAS:<p>Please enquire for more information about Osteocalcin (37-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C75H104N20O19Purity:Min. 95%Molecular weight:1,589.75 g/molcis-4-Hydroxy-D-proline
CAS:<p>Cis-4-Hydroxy-D-proline is a metabolite of the amino acid proline. It has been shown to have beneficial effects on heart function in vitro and in vivo, as well as on collagen synthesis. Cis-4-Hydroxy-D-proline was also shown to inhibit herpes simplex virus replication and to induce apoptosis in hepatocyte-like cells. The affinity constants for cis-4-Hydroxy-D-proline were determined by ph assays, kinetic data, and structural analysis. The optimum pH for cis-4-Hydroxy D proline is 8.0 and the hydroxyl group makes this molecule more soluble in water than other molecules with a similar chemical structure.</p>Formula:C5H9NO3Purity:Min. 95%Color and Shape:White PowderMolecular weight:131.13 g/molIQB-782
CAS:<p>IQB-782 is a mucolytic agent with mucolytic expectorant activity for the study of obstructive lung disease.</p>Formula:C4H9N3O2SPurity:>99.99%Color and Shape:SolidMolecular weight:163.2Z-L-Alanine
CAS:<p>Z-L-Alanine is a cytosolic enzyme inhibitor that inhibits the activity of enzymes involved in protein catalysis. This inhibition is stereoselective, with the L-enantiomer having the stronger inhibitory effect. Z-L-Alanine has been shown to be an effective inhibitor of proteolytic enzymes and has been used as an additive in buffers to prevent enzymatic degradation. Molecular modeling studies have demonstrated that Z-L-Alanine can bind to the active site of these enzymes and inhibit their activity by binding to the catalytic triad of serine, aspartate, and histidine residues. The molecular structure of Z-L-Alanine resembles that of a natural substrate for these enzymes, which may account for its effectiveness in inhibiting them. FTIR spectroscopy has confirmed the presence of Z-L-alanine in a sample obtained from a bacterial culture. Liquid chromatography has shown that this amino acid is present at high levels in various</p>Formula:C11H13NO4Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:223.23 g/molAnti-Inflammatory Peptide 2
CAS:<p>Anti-inflammatory peptide 2 (AIP2) is a small peptide that has been shown to have anti-inflammatory activity. AIP2 inhibits the production of inflammatory mediators such as prostaglandins and leukotrienes. The synthesis of AIP2 is regulated by a hydroxyl group, which may be important for its therapeutic use. AIP2 does not have any side effects and can be used in the treatment of inflammation. <br>The active form of AIP2 is generated from the amino acid sequence H-His-Asp-Met-Asn-Lys-Val-Leu-Asp-Leu. It has been shown that this sequence also inhibits protein synthesis, leading to cell death by inhibiting the production of proteins vital for cell division. <br>The molecular weight of AIP2 is 706 Da and it has two disulfide bonds and two ester linkages. The metal chelate was found to bind with</p>Formula:C46H77N13O15SPurity:Min. 95%Molecular weight:1,084.25 g/mol2-Methylthio-N6-threonylcarbamoyladenosine
CAS:<p>A modified form of adenosine found in bacterial and eukaryotic tRNAs</p>Formula:C16H22N6O8SPurity:Min. 95%Color and Shape:PowderMolecular weight:458.45 g/molFmoc-Pra-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Pra-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Angiotensin I/II (1-6)
CAS:<p>Angiotensin I/II 1-6 is a peptide containing amino acids 1-6; derived from from Angiotensin I/II.</p>Formula:C36H55N11O10Purity:Min. 95%Molecular weight:801.89 g/mol4-Fluoro-3-methoxyphenylacetone
CAS:<p>4-Fluoro-3-methoxyphenylacetone is a high quality reagent that can be used as an intermediate in the synthesis of complex compounds. This compound is also useful for creating fine chemicals and speciality chemicals, for research purposes. 4-Fluoro-3-methoxyphenylacetone has been shown to be a versatile building block in organic synthesis, with many possible applications. It can react with other compounds to create new compounds or react with itself to form new molecules. CAS No. 320338-98-5</p>Formula:C10H11FO2Purity:Min. 95%Molecular weight:182.19 g/mol(Deamino-Cys1,Leu4,Lys8)-Vasopressin trifluoroacetate salt
CAS:<p>Vasopressin is a hormone that belongs to the family of peptide hormones. Vasopressin has been shown to be localized in many tissues, including the brain, where it acts as a neurotransmitter and neuromodulator. Vasopressin is released by the paraventricular nucleus of the hypothalamus and stored in the posterior pituitary gland, from which it is released into the circulation when needed. Vasopressin binds to V1 receptors and causes an increase in cytosolic calcium levels through activation of voltage-gated calcium channels. It also stimulates cell growth and proliferation through activation of tyrosine kinase receptors on cells.</p>Formula:C47H67N11O11S2Purity:Min. 95%Molecular weight:1,026.23 g/mol(D-Ser4,D-Trp6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Ser4,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molH-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
CAS:<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%N2,N6-Bis-cbz-L-lysine
CAS:<p>N2,N6-Bis-cbz-L-lysine is a synthetic acid transporter that is used to inhibit the transport of lysine across the cell membrane. It is an amide, which can be synthesized from lysine and benzoyl chloride. This compound has been shown to have an inhibitory effect on tumor growth in vitro and in vivo. N2,N6-Bis-cbz-L-lysine is active when targeting acidic environments such as tumors. The carbonyl group of this molecule reacts with the hydroxyl group at C4′ on the ribose ring of nucleosides to form a 1,2 diol moiety. This reaction leads to inhibition of DNA synthesis by preventing RNA polymerase from binding to DNA.</p>Formula:C22H26N2O6Purity:Min. 95%Color and Shape:PowderMolecular weight:414.45 g/molDABCYL-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-EDANS trifluoroacetate salt
CAS:Controlled Product<p>DABCYL-gamma-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr (DABCYL) is a fluorescent substrate that has been used to study the kinetics of peptide hydrolysis by proteases. It is an amino acid sequence that is present in angiotensinogen, which is a blood protein involved in regulating blood pressure. The DABCYL group on the terminal amino acid of the peptide provides a highly fluorescent molecule that can be excited at wavelengths longer than 400 nm. This fluorophore can also be used as a donor for fluorescence resonance energy transfer (FRET) with other fluorophores, such as EDANS, which has been shown to have high affinity for DABCYL. DABCYL can be used to measure enzyme activity or inhibition and has been found to be sensitive enough to detect changes due to dilutions at concentrations as low as 10 nM.</p>Formula:C90H120N22O16SPurity:Min. 95%Molecular weight:1,798.12 g/molFmoc-His(1-Trt)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-His(1-Trt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-Val-Leu-Lys-AMC acetate salt
CAS:<p>Boc-Val-Leu-Lys-AMC acetate salt is a protease inhibitor that binds to the active site of trypsin and inhibits its proteolytic activity. It has been shown to protect neuronal cells from death caused by amyloid beta (Aβ) peptide. Boc-Val-Leu-Lys-AMC acetate salt also inhibits the secretion of proinflammatory cytokines and reduces the permeability of mitochondrial membranes in human neutrophils. This drug is stable in acidic environments, with a pH optimum of 2.0, but is sensitive to alkaline conditions with a pH optimum of 8.5. Boc-Val-Leu-Lys-AMC acetate salt has been shown to bind to casein, which may result in high values on sephadex g100 chromatography.</p>Formula:C32H49N5O7•C2H4O2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:675.81 g/molOrphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C126H195N37O37Purity:Min. 95%Molecular weight:2,820.12 g/molNeuromedin B trifluoroacetate salt
CAS:<p>Neuromedin B is a peptide hormone that is produced by the hypothalamus and regulates many physiological processes such as energy metabolism, appetite, and sleep. Neuromedin B is a member of the family of guanine nucleotide-binding proteins (G proteins) that bind to G protein-coupled receptors on the surface of cells. It has been shown to stimulate calcium release from intracellular stores in response to an increase in cytosolic Ca2+. Neuromedin B has been shown to have anti-inflammatory effects on infectious diseases such as meningitis, sepsis, and tuberculosis, which may be due to its ability to inhibit neutrophil migration. Neuromedin B also stimulates hippocampal formation activity in rats during the rotarod test, which may be due to its effects on dopamine release.</p>Formula:C52H73N15O12SPurity:Min. 95%Molecular weight:1,132.3 g/molMyristoyl-Lys-Arg-Thr-Leu-Arg-OH
CAS:<p>Myristoyl-Lys-Arg-Thr-Leu-Arg-OH is a synthetic compound that interacts with tyrosine kinase substrate proteins. It inhibits the activation of these proteins and prevents the phosphorylation of tyrosine residues in other substrate proteins. Myristoyl-Lys-Arg-Thr-Leu-Arg-OH has been shown to have potent inhibitory activity against IL2 receptor and adriamycin, which are protein kinases that play important roles in the death pathway.</p>Formula:C42H82N12O8Purity:Min. 95%Molecular weight:883.18 g/mol2-Methyl-N-phenyl-5,6-dihydro-1,4-oxathiine-3-carboxamide
CAS:<p>2-Methyl-N-phenyl-5,6-dihydro-1,4-oxathiine-3-carboxamide is a signal molecule that has antimicrobial activity. It inhibits the proliferation of cells and is used as an antifungal agent. 2,5,6-Trimethyloxathiinium ion has been shown to induce apoptosis in human leukemia cells and inhibit the growth of erythrocytes infected with Plasmodium falciparum. This compound also inhibits wild type strains of bacteria and fungi and can be used as a natural fungicide. 2,5,6-Trimethyloxathiinium ion has been found to be effective in treating autoimmune diseases such as diabetes mellitus type II, which may be due to its ability to regulate glucose metabolism and suppress inflammatory responses.</p>Formula:C12H13NO2SPurity:Min. 95%Molecular weight:235.3 g/molMeOSuc-Ala-Ala-Pro-Val-chloromethylketone
CAS:<p>MeOSuc-Ala-Ala-Pro-Val-chloromethylketone is a serine protease inhibitor that has been shown to be effective against influenza virus and HIV. It was found to be active against a number of serine proteases, such as trypsin, chymotrypsin, and elastase. MeOSuc-Ala-Ala-Pro-Val-chloromethylketone also has chemotactic activity in thp1 cells and lung fibroblasts. It is activated by the addition of water and has been shown to inhibit the growth of soybean trypsin. However, it does not have any effect on human trypsin.</p>Formula:C22H35ClN4O7Purity:Min. 95%Molecular weight:502.99 g/molH-Glu-Asn-Asp-Tyr(PO3H2)-Ile-Asn-Ala-Ser-Leu-OH
CAS:<p>Please enquire for more information about H-Glu-Asn-Asp-Tyr(PO3H2)-Ile-Asn-Ala-Ser-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H68N11O21PPurity:Min. 95%Molecular weight:1,118.05 g/molLHRH hydrochloride salt
CAS:<p>LHRH is a hormone that has been used to treat endometriosis, prostate cancer, and ovarian cysts. It is an agonist of the gonadotropin-releasing hormone receptor (GnRH receptor). LHRH binds to the GnRH receptor in the pituitary gland and stimulates the release of follicle-stimulating hormone and luteinizing hormone. This leads to increased production of estrogen and testosterone. LHRH has been shown to be effective in treating infectious diseases such as tuberculosis and HIV/AIDS. LHRH can also be used as a diagnostic aid for determining whether or not a tumor is cancerous by measuring its protein content.</p>Formula:C55H75N17O13·xHClPurity:Min. 95%Molecular weight:1,182.29 g/molLeptin (116-130) amide (mouse) trifluoroacetate salt
CAS:<p>Amide; Trifluoroacetate salt</p>Formula:C64H109N19O24SPurity:Min. 95%Molecular weight:1,560.73 g/molLHRH (7-10)·2 HCl
CAS:<p>Please enquire for more information about LHRH (7-10)·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H36N8O4·2HClPurity:Min. 95%Molecular weight:513.46 g/molAcetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H207N39O30SPurity:Min. 95%Molecular weight:2,888.4 g/mol(Sar 1,Val5,Ala8)-Angiotensin II trifluoroacetate salt
CAS:<p>Angiotensin II is a peptide hormone that is also known as angiotensin II trifluoroacetate salt. It has been shown to have cardioprotective effects in vivo and in vitro models. Angiotensin II has been shown to induce follicular growth, inhibit atherosclerotic lesion formation, and improve cardiac function. Angiotensin II can be used to treat patients with congestive heart failure or cardiovascular disease due to its ability to increase blood pressure and the rate of cardiac contractions. The drug also reduces systolic pressure by acting on receptors in the kidneys and vasculature, which are involved in the renin-angiotensin system.</p>Formula:C42H65N13O10•C2HF3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:1,026.07 g/molHTLV-1 Tax (11-19) trifluoroacetate salt
CAS:<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H79N9O12Purity:Min. 95%Molecular weight:1,070.28 g/molBoc-Cys(SEt)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Boc-Cys(SEt)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H19NO4S2·C12H23NPurity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:462.71Mca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H81N15O19Purity:Min. 95%Molecular weight:1,388.44 g/mol([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt
<p>Please enquire for more information about ([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%LHRH (free acid) trifluoroacetate salt
CAS:<p>LHRH (free acid) trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-OH trifluoroacetate salt is a decapeptide that is the most potent form of the hormone luteinizing hormone releasing hormone (LHRH). It has been shown to bind to surface receptors and activate a G protein, which activates adenyl cyclase. This leads to increased levels of cyclic adenosine monophosphate (cAMP) in cells. LHRH also binds to blood vessels and causes vasodilation. LHRH also binds to pyroglutamic acid, which is an amino acid found in peptides that have affinity for peptidases. This binding causes the release of peptidases from the cell membrane, uncovers receptor sites, and increases cAMP production. LHRH has also been shown to inhibit kidney function</p>Formula:C55H74N16O14Purity:Min. 95%Molecular weight:1,183.28 g/molBoc-Thr(Bzl)-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Thr(Bzl)-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%GM-CSF (17-31)
CAS:<p>Please enquire for more information about GM-CSF (17-31) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C73H129N27O24Purity:Min. 95%Molecular weight:1,768.97 g/molTRAP-6 (2-6) trifluoroacetate salt
CAS:<p>TRAP-6 (2-6) is a monoclonal antibody that binds to the enzyme collagenase, which is an important factor in tumor invasion and metastasis. The antibody binds to the active site of collagenase, thereby inhibiting its activity. TRAP-6 (2-6) has been shown to reduce the growth of cancer cells by inhibiting the production of β-amino acids and zymogens, which are required for tumor cell proliferation. It also inhibits serine proteases, such as thrombin receptor, which play an important role in tumor invasion and metastasis. TRAP-6 (2-6) also has anti-inflammatory properties and can be used for the treatment of basophilic leukemia.</p>Formula:C31H51N9O7Purity:Min. 95%Molecular weight:661.79 g/molLactoferricin B (4-14) (bovine) trifluoroacetate salt
CAS:<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>Formula:C70H113N25O13SPurity:Min. 95%Molecular weight:1,544.87 g/molH-Asn-Glu-Ala-Tyr-Val-His-Asp-Ala-Pro-Val-Arg-Ser-Leu-Asn-OH
CAS:<p>H-Asn-Glu-Ala-Tyr-Val-His-Asp-Ala-Pro-Val-Arg-Ser-Leu-Asn is a cytosolic protein that is an inhibitor of protein synthesis. It has been shown to inhibit the activity of proteases, such as caspase 1, and to activate caspase 1. This inhibition is consequent to the inhibition of polypeptide chain elongation and may be due to the ability of HAAHTVHAAPVVAALAHPVKVALARGSRLEUANNSOH to bind to peptidyl transferase or other proteins involved in protein synthesis. HAAHTVHAAPVVAALAHPVKVALARGSRLEUANNSOH binds to primary keratinocytes and k562 cells more efficiently than it does to thp1 cells, suggesting that it may have a role in skin cancer.</p>Formula:C68H105N21O23Purity:Min. 95%Molecular weight:1,584.69 g/molN-Benzoyl-N-phenylhydroxylamine
CAS:<p>N-Benzoyl-N-phenylhydroxylamine is a compound that has been shown to be an optimum concentration for the production of molybdenum. It is a model system for the extraction and separation of molybdenum from other metals. The extraction process involves acidification with nitric acid, followed by precipitation with sodium benzoate. N-Benzoyl-N-phenylhydroxylamine is extracted using an electrode and then purified with a metal chelate. This compound has been shown to have synergistic effects when combined with vanadium, which may be due to their similar chemical properties.</p>Formula:C13H11NO2Purity:Min. 95%Molecular weight:213.23 g/mol2-Isobutyl-3-methoxypyrazine
CAS:<p>2-Isobutyl-3-methoxypyrazine is a hydrophobic compound that is not soluble in water. It has a bound form and can be titrated with calorimetry. 2-Isobutyl-3-methoxypyrazine is synthesized by reacting 2,2,4-trimethylpentane with methoxyacetone in the presence of sodium methylate. The compound has been detected as an odorant in numerous plant species and is believed to play a role in plant physiology. 2-Isobutyl-3-methoxypyrazine has been shown to have potent antiviral activity against infectious diseases such as HIV, herpes simplex virus type 1 (HSV1), and varicella zoster virus (VZV). This specific antiviral activity may be due to its ability to bind fatty acids by hydrogen bonds, which may interfere with the synthesis of viral membranes.</p>Formula:C9H14N2OPurity:Min. 95%Molecular weight:166.22 g/molZ-Tyr-Phe-OH
CAS:<p>Please enquire for more information about Z-Tyr-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H26N2O6Purity:Min. 95%Molecular weight:462.49 g/molH-Asp-Pro-Gln-Phe-Tyr-OH hydrochloride salt
CAS:<p>Please enquire for more information about H-Asp-Pro-Gln-Phe-Tyr-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H40N6O10Purity:Min. 95%Molecular weight:668.69 g/molZ-Gly-Ala-Pro-bNA
CAS:<p>Z-Gly-Ala-Pro-bNA is a peptidase that hydrolyzes peptides. The peptidase has two catalytic domains, which are located at the N and C termini of the protein. The N-terminal domain contains an oligopeptidase motif that has been shown to be important for the hydrolysis of substrates with hydrophobic residues. The C-terminal domain contains a cavity, which is necessary for binding to substrate and catalysis. This catalytic domain also contains an acid substitution, which may contribute to its stability in acidic environments. A mutant form of Z-Gly-Ala-Pro-bNA was generated by changing the amino acid residue at position n from serine to asparagine, which led to an increase in thermostability and in catalytic activity.</p>Formula:C28H30N4O5Purity:Min. 95%Molecular weight:502.56 g/molH-Lys-Thr-Tyr-OH
CAS:<p>Please enquire for more information about H-Lys-Thr-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H30N4O6Purity:Min. 95%Molecular weight:410.46 g/molH-Gly-2-chlorotrityl resin (200-400 mesh)
CAS:<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H1-7 acetate salt
CAS:<p>H1-7 acetate salt H-Arg-Arg-Lys-Ala-Ser-Gly-Pro-OH acetate salt is a synthetic, ternary complex of the amino acid histidine, arginine and lysine. It has been shown to inhibit β lactamase enzymes that are responsible for the hydrolysis of penicillin, cephalosporin, and monobactam antibiotics. The inhibition is due to the hydrophobic nature of the substrate binding site on β lactamase. This binding prevents the enzyme from hydrolyzing its substrate and inactivates it. In addition, H1-7 acetate salt H-Arg-Arg-Lys-Ala-Ser-Gly-Pro-OH acetate salt binds to calcium ions and has been shown to have a kinetic effect on β lactamases.</p>Formula:C31H58N14O9Purity:Min. 95%Molecular weight:770.88 g/molDynorphin A (1-8) acetate salt
CAS:<p>Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt is a synthetic, nonpeptide opioid agonist. It binds to the delta receptor and inhibits nociception in the central nervous system. This compound has been shown to produce acute phase and subchronic toxicity in rats and has been shown to possess antinociceptive effects in mice. Dynorphin A (1-8) acetate salt H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-OH acetate salt has also been shown to antagonize the enzyme inhibitors of phospholipase A2, cyclooxygenase, and lipoxygenase.<br>MECHANISM OF ACTION: Dynorphin A (1–8) is an endogenous peptide that modulates neurotransmission at the</p>Formula:C46H72N14O10Purity:Min. 95%Molecular weight:981.15 g/molToxic Shock Syndrome Toxin-1 (TSST-1) (58-78)
CAS:<p>Please enquire for more information about Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H171N33O35Purity:Min. 95%Molecular weight:2,371.61 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C159H267N49O43Purity:Min. 95%Molecular weight:3,553.13 g/mol2-Methylthio-cis-zeatin
CAS:<p>2-Methylthio-cis-zeatin is a corynebacterium metabolite that is produced by the oxidative deamination of 2-methylthioadenosine. It can be used as an indicator for the presence of corynebacteria in various plant species and has been found to have physiological functions such as multiple-reaction monitoring, biochemical analysis, and chemical structures. The production of 2-methylthio-cis-zeatin has been detected in tissue culture and explants from plants. Chemical analyses have shown that this metabolite is an impurity or contaminant in some pharmaceuticals and food products. 2-Methylthio-cis-zeatin can be identified using chromatographic methods with a mass spectrometric detection (MS) method, which allows for the identification of its isomers. This metabolite can also be analyzed using chromatographic methods with MS detection, which allows for the identification of its isomers</p>Formula:C11H15N5OSPurity:Min. 95%Molecular weight:265.34 g/molH-Lys-Lys-Arg-Ala-Ala-Arg-Ala-Thr-Ser-Asn-Val-Phe-Ala-NH2
CAS:<p>Please enquire for more information about H-Lys-Lys-Arg-Ala-Ala-Arg-Ala-Thr-Ser-Asn-Val-Phe-Ala-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H107N23O16Purity:Min. 95%Molecular weight:1,418.65 g/molCyclo(-Gly-Asn-Trp-His-Gly-Thr-Ala-Pro-Asp)-Trp-Val-Tyr-Phe-Ala-His-Leu-Asp-Ile-Ile-Trp-OH
CAS:<p>Please enquire for more information about Cyclo(-Gly-Asn-Trp-His-Gly-Thr-Ala-Pro-Asp)-Trp-Val-Tyr-Phe-Ala-His-Leu-Asp-Ile-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H150N28O27Purity:Min. 95%Molecular weight:2,380.62 g/mol3-Bromo-2-methylaniline
CAS:<p>3-Bromo-2-methylaniline is a six membered, planar, planar conformation with a dihedral angle of 120°. The molecule has two dimers that are connected by hydrogen bonds. It has a crystal structure that is made up of molecules arranged in a hexagonal grid. The molecule is made up of three atoms: one carbon atom, one nitrogen atom, and one bromine atom. The three atoms are arranged in the following order: bromine, carbon, nitrogen.</p>Formula:C7H8BrNPurity:Min. 95%Color and Shape:Clear Colourless To Yellow To Brown Or Red-BrownMolecular weight:186.05 g/mol(Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C121H189N33O36Purity:Min. 95%Molecular weight:2,682 g/molH-Gly-Gly-Met-OH
CAS:<p>H-Gly-Gly-Met-OH is a hydrophobic amino acid with a decelerated reaction. It has been shown to modulate the growth of organisms, such as Staphylococcus aureus and Streptococcus pneumoniae. This molecule also has aspirin-like activity against S. aureus and can be used for cavity prevention. H-Gly-Gly-Met-OH is effective in inhibiting the growth of S. aureus, but not against Streptococcus pneumoniae. The test organism used in this study was Escherichia coli K12. H-Gly-Gly-Met-OH has been shown to have sequences that are similar to those found in kinetically slow peptides and tripeptides, which may explain its stability when encapsulated in liposomes for oral administration.</p>Formula:C9H17N3O4SPurity:Min. 95%Molecular weight:263.32 g/molFmoc-Ile-Ser(Psi(Me ,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Ile-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H32N2O6Purity:Min. 95%Molecular weight:480.55 g/molZ-Ala-Phe-OMe
CAS:<p>Z-Ala-Phe-OMe is a model amide that has been used to study the serine protease catalysed hydrolysis of peptides. This compound is a water molecule analogue that is immobilized on an ion exchange resin, which can be used as a support for experiments in catalysis and thermodynamics. Z-Ala-Phe-OMe has shown to be more efficient than other substrates and can be used to study kinetic data and thermodynamic properties.</p>Formula:C21H24N2O5Purity:Min. 95%Molecular weight:384.43 g/molMca-Arg-Pro-Lys-Pro-Gln-OH
CAS:<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C39H56N10O11Purity:Min. 95%Molecular weight:840.92 g/molNeuropeptide Y (3-36) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (3-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C176H271N53O54Purity:Min. 95%Molecular weight:3,993.36 g/mol(D-Tyr5,D-Ser(tBu)6,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (D-Tyr5,D-Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O14Purity:Min. 95%Molecular weight:1,269.41 g/molNeuropeptide W-30 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide W-30 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C165H249N49O38SPurity:Min. 95%Molecular weight:3,559.12 g/molDansyl-Ala-Arg-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about Dansyl-Ala-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30N6O5SPurity:Min. 95%Molecular weight:478.57 g/molH-Phe-Leu-Arg-Phe-NH2 acetate salt
CAS:<p>H-Phe-Leu-Arg-Phe-NH2 acetate salt is a peptide that has been shown to inhibit neuronal activity in the Xenopus oocyte. This inhibition is biphasic and can be reversed by the addition of an excess of glutamate. It has been shown to have an inhibitory effect on the release of neurotransmitters from the isolated heart, ganglia, and subesophageal ganglion. The sequence of H-Phe-Leu-Arg-Phe-NH2 acetate salt has been determined as carboxy terminal. The physiological effects of H-Phe-Leu-Arg-Phe-NH2 acetate salt are related to its receptor binding properties.</p>Formula:C30H44N8O4Purity:Min. 95%Molecular weight:580.72 g/molH-Ile-His-OH
CAS:<p>H-Ile-His-OH is a peptide that has been found to be an antagonist of the epidermal growth factor receptor. It has been shown to decrease inflammation in animal models of bowel disease and may be useful in the treatment of inflammatory bowel disease. H-Ile-His-OH has also been shown to inhibit the production of inflammatory cytokines such as IL-1β, IL-6, and TNF α. This peptide also inhibits monoclonal antibody production by dendritic cells and can prevent resistant mutants from developing. H-Ile-His-OH is a potent antagonist of Toll-Like Receptor (TLR) 4, TLR2, TLR3, and TLR9. H-Ile-His-OH is currently being investigated for its possible role in the treatment of infectious diseases and autoimmune diseases.</p>Formula:C12H20N4O3Purity:Min. 95%Molecular weight:268.31 g/molJKC-301 Cyclo(-D-Asp-Pro-D-Ile-Leu-D-Trp)
CAS:<p>Please enquire for more information about JKC-301 Cyclo(-D-Asp-Pro-D-Ile-Leu-D-Trp) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H44N6O7Purity:Min. 95%Molecular weight:624.73 g/molH-Lys(isopropyl)-OH
CAS:<p>Please enquire for more information about H-Lys(isopropyl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H20N2O2Purity:Min. 95%Molecular weight:188.27 g/molH-Gln-Gly-Pro-OH·TFA
CAS:<p>Please enquire for more information about H-Gln-Gly-Pro-OH·TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H20N4O5·C2HF3O2Purity:Min. 95%Molecular weight:414.33 g/mol4-[2-(Fmoc-amino)ethyl]-1-piperazineacetic acid dihydrochloride
CAS:<p>Please enquire for more information about 4-[2-(Fmoc-amino)ethyl]-1-piperazineacetic acid dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H27N3O4•2HClPurity:Min. 95%Color and Shape:PowderMolecular weight:482.4 g/mol(D-Pro4,D-Trp7·9·10)-Substance P (4-11)
CAS:<p>Substance P is a neuropeptide that is found in the central nervous system. It is also found in the gastrointestinal tract and plays a role in the regulation of smooth muscle contraction. Substance P has been shown to be involved in inflammatory responses, immune responses, and regulation of water and electrolyte balance. The maximal response of substance P occurs at concentrations between 0.1 to 1 nM and its inhibitory effect on the apical Ca2+ response occurs at concentrations between 10-100 nM. In addition, substance P has been shown to have an excitatory effect on 5-HT7 receptors with subunit composition GluN1/GluN2A/GluN2B/GluN3A/5-HT7(H).</p>Formula:C62H74N14O10SPurity:Min. 95%Molecular weight:1,207.41 g/molCalcium-Like Peptide 3 trifluoroacetate salt
CAS:<p>Please enquire for more information about Calcium-Like Peptide 3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H68N10O9Purity:Min. 95%Molecular weight:881.07 g/molN-Methyl-N-boc-aminopropan-3-ol
CAS:<p>N-Methyl-N-boc-aminopropan-3-ol is a fine chemical with CAS No. 98642-44-5 that is used in the synthesis of complex compounds, as a reagent for research chemicals, and as a speciality chemical. It is also used in the synthesis of versatile building blocks, reaction components and scaffolds. N-Methyl-N-boc-aminopropan-3-ol has a high quality and can be used as a versatile intermediate or a useful scaffold.</p>Formula:C9H19NO3Purity:Min. 95%Color and Shape:Colourless To Pale Yellow LiquidMolecular weight:189.25 g/molAc-muramyl-D-Ala-D-Glu-NH2
CAS:<p>Please enquire for more information about Ac-muramyl-D-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H32N4O11Purity:Min. 95%Molecular weight:492.48 g/mol(Met(O)5)-Enkephalin
CAS:<p>Met-enkephalin is a molecule that is formed from two of the three parts of the endorphin molecule, which are Tyr-Gly-Gly-Phe and Met(O)OH. It is a neurotransmitter that has been shown to inhibit pain in humans and animals. In coelomocytes, met-enkephalin binds to receptors on the cell membrane and inhibits the release of dopamine by binding to dopamine receptors. The sulfoxide group of this molecule can be reduced to form enkephalinase, which is an enzyme that cleaves Met(O)OH from the peptide chain. This process is not known to occur in humans or other mammals. Met-enkephalin has been localized in ganglia cells in animals, but not humans. It has also been found in messenger RNA (mRNA) for translation into protein, but it does not appear to be translated into protein in humans or other mammals.</p>Formula:C27H35N5O8SPurity:Min. 95%Molecular weight:589.66 g/molAc-Phe-Glu-Trp-Thr-Pro-Gly-Trp-Tyr-Gln-L-azetidine-2-carbonyl-Tyr-Ala-Leu-Pro-Leu-NH2
CAS:<p>The peptide Ac-Phe-Glu-Trp-Thr-Pro-Gly-Trp-Tyr-Gln-L-azetidine-2-carbonyl-Tyr-Ala-Leu-Pro-Leu (AFGP) is a small molecule that has been shown to be effective in the prophylaxis and treatment of infectious diseases. AFGP is used as an excipient in intravenous solutions, such as antibiotics, vaccines, and other injectable drugs. It also functions as a diluent for lyophilized products. In addition to its use in the pharmaceutical industry, AFGP is also used as an excipient for vaccine preparations and other injectable drugs. AFGP has been shown to reduce the symptoms of inflammatory diseases, such as asthma and rheumatoid arthritis. This peptide has also been shown to have antiinflammatory and antifibrotic properties.</p>Formula:C96H123N19O22Purity:Min. 95%Molecular weight:1,895.12 g/mol3-Iodo-2-methylbenzoic acid
CAS:<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>Formula:C8H7IO2Purity:Min. 95%Color and Shape:SolidMolecular weight:262.04 g/molBiotinyl-Obestatin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C124H188N36O33SPurity:Min. 95%Molecular weight:2,743.11 g/molS-(1,2-Dicarboxyethyl)glutathione
CAS:<p>S-(1,2-Dicarboxyethyl)glutathione is a glutathione analogue that has been shown to prevent acetaminophen-induced hepatotoxicity in mice. It inhibits the reaction between acetaminophen and hepatic microsomal cytochrome P450 enzymes, which prevents the formation of toxic metabolites. S-(1,2-Dicarboxyethyl)glutathione also inhibits the production of serotonin by inhibiting the enzyme tryptophan hydroxylase. This drug has an anticoagulant effect by preventing the conversion of prothrombin to thrombin. S-(1,2-Dicarboxyethyl)glutathione also affects growth factors and collagen synthesis by affecting both epidermal growth factor (EGF) and fibroblast growth factor (FGF). The optimum pH for this drug is at 7.0.</p>Formula:C14H21N3O10SPurity:Min. 95%Molecular weight:423.4 g/molZ-Glu-Gly-OH
CAS:<p>Z-Glu-Gly-OH is a cysteine donor for the chemical cross-linking of keratin proteins. Follicle cells are a major source of keratin, and glutamic acid is the most abundant amino acid in these cells. Glutamine is also abundant in keratins, and may be responsible for the cornified layer. Cysteine is used to cross-link the structural proteins, while glutamic acid and glutamine are involved in cross-linking the fibre and residue. Cross-linking results in an insoluble protein matrix that provides strength to skin.</p>Formula:C15H18N2O7Purity:Min. 95%Molecular weight:338.31 g/molH-Gly-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N4O4Purity:Min. 95%Molecular weight:260.29 g/mol(Pyr 1)-Opiorphin trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pyr 1)-Opiorphin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H45N11O8Purity:Min. 95%Molecular weight:675.74 g/molFurin Inhibitor II trifluoroacetate salt
CAS:<p>Furin inhibitor II is a small molecule that inhibits the activity of furin, which is an enzyme used in the processing of growth factor-β1. Furin inhibitor II binds to human receptors and blocks their binding to the surface glycoprotein on cancer cells. Furin inhibitor II also has physiological activities, such as reducing inflammation, inhibiting viral replication, and inhibiting the growth of bacteria. Furin inhibitor II may be useful for treating cancer or infectious diseases.</p>Formula:C36H75N25O6Purity:Min. 95%Molecular weight:954.15 g/molZ-Leu-Leu-Nle-aldehyde
CAS:<p>Z-Leu-Leu-Nle (ZLL) is a small molecule that selectively inhibits the activity of the aspartyl protease, BACE1, which is an enzyme that cleaves amyloid precursor protein (APP) to produce amyloid beta peptides. The inhibition of this enzyme has been shown to be effective in preventing or delaying the onset of Alzheimer's disease. ZLL also inhibits estrogen receptor alpha and has antiestrogenic effects in breast cancer cells. This compound induces apoptosis by binding to apoptotic proteins, such as tumor necrosis factor receptor 1, Fas ligand, and TRAIL receptors. It also inhibits cell growth and induces chemoresistance in breast cancer cells.</p>Formula:C26H41N3O5Purity:Min. 95%Molecular weight:475.62 g/molBoc-Pro-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Pro-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Val-Tyr-Val-OH
CAS:<p>H-Val-Tyr-Val-OH is a water soluble polymer that has a sulfamic acid group and a hydroxyl group. The polymer film is used as an additive for cellulose acetate, which is used in the manufacture of films, lacquers, and adhesives. H-Val-Tyr-Val-OH increases the solubility of the cellulose acetate in hydrochloric acid and reduces its tendency to dissolve in water. H-Val-Tyr-Val-OH also has a high degree of uv absorption. Constant techniques are used for analytical chemistry, such as gas chromatography and nuclear magnetic resonance spectroscopy, to study the surface properties of micelles formed from H-Val-Tyr-Val-OH.</p>Formula:C19H29N3O5Purity:Min. 95%Molecular weight:379.45 g/molBiotinyl-Asp-Glu-Val-Asp-aldehyde (pseudo acid)
CAS:<p>Biotinyl-Asp-Glu-Val-Asp-aldehyde (pseudo acid) is a biotinylated amino acid, which can be used to study the affinity of caspases and other proteases. Biotin binds to the peptide through an amide bond and the amino group on the biotin molecule reacts with reactive groups on proteins, such as lysine, cysteine, histidine, or arginine. This reaction leads to the formation of a stable link between biotin and the target protein. The biotinylated peptide can then be purified from a sample by using an affinity chromatography column that has been pre-coated with streptavidin.<br>Biotin is not toxic because it does not bind to DNA.</p>Formula:C28H42N6O12SPurity:Min. 95%Molecular weight:686.73 g/molN-Boc-isonipecotic acid
CAS:<p>N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/mol3-Methylpyrazole
CAS:<p>3-Methylpyrazole is a heterocyclic compound that is an analogue of pyrazole. It has been shown to inhibit the growth of prostate cancer cells and may be used as an experimental model for human serum. 3-Methylpyrazole was able to decrease the expression of phosphorylated p38 mitogen-activated protein kinase (MAPK) in LNCaP cells. It also showed selectivity for group P2 protein kinases over group A, B, and C protein kinases. 3-Methylpyrazole is not active against methicillin resistant Staphylococcus aureus.</p>Formula:C4H6N2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:82.1 g/mol(2-Methoxypropyl)amine hydrochloride
CAS:<p>2-Methoxypropyl)amine hydrochloride (2MPPA) is a versatile building block that can be used in the synthesis of complex compounds. It is a research chemical that is used as a reagent and as a speciality chemical for the production of pharmaceuticals, agrochemicals, and other organic chemicals. 2MPPA can be used as an intermediate in the manufacture of useful scaffolds or useful reaction components. This product has CAS number 70807-90-8 and is of high quality.</p>Formula:C4H11NO·HClPurity:Min. 95%Color and Shape:SolidMolecular weight:125.6 g/molH-Met-D-Met-OH
CAS:<p>Please enquire for more information about H-Met-D-Met-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O3S2Purity:Min. 95%Molecular weight:280.41 g/mol(1S,2R)-Fmoc-aminocyclohexane carboxylic acid
CAS:<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23NO4Purity:Min. 95%Molecular weight:365.42 g/molH-Gly-Gly-b-Ala-OH
CAS:<p>Please enquire for more information about H-Gly-Gly-b-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H13N3O4Purity:Min. 95%Molecular weight:203.2 g/molSuc-Gly-Gly-Phe-pNA
CAS:<p>Suc-Gly-Gly-Phe-pNA is a colorimetric substrate for Chymotrypsin and Streptomyces griseus protease B. Activity is quantified by the release of p-nitroaniline which is measured by absorbance at 405 nm.</p>Formula:C23H25N5O8Purity:Min. 95%Molecular weight:499.47 g/molH-Asp-Asp-Asp-OH
CAS:<p>H-Asp-Asp-Asp-OH is a peptide that has been shown to disrupt the cytosol and cause apoptosis. It can also induce proteolytic maturation and modulate autocatalytic functions. H-Asp-Asp-Asp-OH induces apoptosis by activating caspase 9 and caspase 3, which cleaves poly (ADP ribose) polymerase (PARP). This leads to DNA fragmentation, chromatin condensation, nuclear fragmentation, cell shrinkage, membrane blebbing, and nuclear pyknosis. H-Asp-Asp-Asp-OH binds to the regulatory domain of caspase 9 and prevents it from being activated. The peptide also activates caspase 8 by binding to its regulatory domain, which then activates caspases 3 and 7. H-Asp-Asp-Asp-OH also stimulates the release of granzyme B from cytot</p>Formula:C12H17N3O10Purity:Min. 95%Molecular weight:363.28 g/mol(Lauroyl-Cys-Tyr-Gly(-Glu-Glu-Asn-Val)6-OH)2 (Disulfide bond)
CAS:<p>Please enquire for more information about (Lauroyl-Cys-Tyr-Gly(-Glu-Glu-Asn-Val)6-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C280H428N66O120S2Purity:Min. 95%Molecular weight:6,702.9 g/molPrepro-Neuromedin S (70-103) (human) trifluoroacetate salt
<p>Please enquire for more information about Prepro-Neuromedin S (70-103) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C180H271N49O44SPurity:Min. 95%Molecular weight:3,857.45 g/mol4-Fluoro-2-methoxyaniline
CAS:<p>4-Fluoro-2-methoxyaniline is an inhibitor of tyrosine kinase. It is a molecule that has been isolated from the ground leaves of erythroxylon coca and is used in the treatment of diabetes mellitus. 4-Fluoro-2-methoxyaniline inhibits the growth factor receptor, epidermal growth factor (EGF), and its receptor, EGF receptor. This inhibition leads to decreased proliferation of epidermal cells and decreased insulin production by pancreatic beta cells. 4-Fluoro-2-methoxyaniline also has antioxidant properties, which may be due to its ability to scavenge free radicals.</p>Formula:C7H8FNOPurity:Min. 95%Color and Shape:Light Brown To Brown LiquidMolecular weight:141.14 g/molPotassium 4-methoxycinnamate
CAS:<p>Potassium 4-methoxycinnamate is a fine chemical that is used as a versatile building block in the synthesis of complex compounds. It can be used in research and as a reagent or speciality chemical. It is also a useful building block for high quality, useful intermediate, and reaction component. Potassium 4-methoxycinnamate can be used as a scaffold to synthesize compounds with diverse applications such as pharmaceuticals, polymers, and agrochemicals.</p>Formula:C10H9O3·KPurity:Min. 95%Molecular weight:216.27 g/molN-((RS)-2-Hydroxy-2-phenyl-ethyl)-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-((RS)-2-Hydroxy-2-phenyl-ethyl)-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H35N3O3Purity:Min. 95%Molecular weight:425.56 g/molPyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Pyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H57N13O9Purity:Min. 95%Molecular weight:827.93 g/molH-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Glu(Ala-Gly-pNA)-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H21N5O7Purity:Min. 95%Molecular weight:395.37 g/mol(Propionyl1,D-Tyr(Et)2,Val4, Abu 6,Arg8·9)-Vasopressin
CAS:<p>Please enquire for more information about (Propionyl1,D-Tyr(Et)2,Val4, Abu 6,Arg8·9)-Vasopressin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H82N16O11Purity:Min. 95%Molecular weight:1,119.32 g/molH-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH
CAS:<p>Please enquire for more information about H-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H77N13O11Purity:Min. 95%Molecular weight:1,156.33 g/molAc-Ile-Glu-Thr-Asp-aldehyde (pseudo acid)
CAS:<p>Ac-Ile-Glu-Thr-Asp-aldehyde (pseudo acid) is a neurotrophic factor that plays an important role in the development and function of the nervous system. It stimulates the production of other neurotrophic factors such as NGF, BDNF, and GDNF. This protein has been shown to be involved in a number of autoimmune diseases, including multiple sclerosis and rheumatoid arthritis. Ac-Ile-Glu-Thr-Asp-aldehyde (pseudo acid) is also known to reduce neuronal death by binding to toll receptors on neurons and activating mitogen activated protein kinases. Acetylcholine esterase activity can also be inhibited by this protein. Acetylcholine esterase is responsible for breaking down acetylcholine, which is a neurotransmitter that transmits nerve impulses across the synapses between neurons. The inhibition of this enzyme leads to an increase in acetylcholine levels and increased transmission of</p>Formula:C21H34N4O10Purity:Min. 95%Molecular weight:502.52 g/molZ-Gly-Gly-Leu-pNA
CAS:<p>The peptide z-Gly-Gly-Leu-pNA is a synthetic substrate that is used in the study of metalloendopeptidases. The peptide is composed of four amino acids and has an acidic, monoclonal antibody, dodecyl, proteolytic, peptide hormones, extracellular, inactivated, serine protease. It is synthesized from wheat leaves and can be used as a substrate for the enzyme.</p>Formula:C24H29N5O7Purity:Min. 95%Molecular weight:499.52 g/molH-D-Tyr-Val-Gly-OH
CAS:<p>H-D-Tyr-Val-Gly-OH is a catalyst that is used in the synthesis of phenylhydrazones. It catalyses the condensation of an aromatic aldehyde and hydrazine, which leads to the formation of a phenylhydrazone. The reaction occurs at neutral pH and high temperature. H-D-Tyr-Val-Gly-OH has been shown to inhibit protein synthesis in rat liver cells, with its inhibitory effect increasing with increased pH.</p>Formula:C16H23N3O5Purity:Min. 95%Molecular weight:337.37 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N42O39Purity:Min. 95%Molecular weight:3,229.65 g/molEndothelin-3 (human, mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C121H168N26O33S4Purity:Min. 95%Molecular weight:2,643.05 g/molUrocortin (human) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C204H337N63O64Purity:Min. 95%Molecular weight:4,696.24 g/molAcetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt
CAS:<p>Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu-NH2 trifluoroacetate salt is a prophylactic and/or therapeutic compound that has been shown to be effective in the treatment of a number of different diseases. This compound has been shown to have neuroprotective and antiinflammatory effects, as well as being an effective treatment for autoimmune disorders. Acetyl-GRP (20-26) (human, porcine, canine) trifluoroacetate salt Ac-His-Trp-Ala-Val-Gly-His-Leu NH2 trifluoroacetate salt also has the potential to be used as a prophylactic or therapeutic agent against cancer, fibrotic disease, and inflammatory disease.</p>Formula:C41H57N13O8Purity:Min. 95%Molecular weight:859.97 g/molLys(Dabsyl)-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-676)-Gln-Lucifer Yellow ammonium salt
CAS:<p>Please enquire for more information about Lys(Dabsyl)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Gln-Lucifer Yellow ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C89H122N24O31S3Purity:Min. 95%Molecular weight:2,120.26 g/molBiotinyl-(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C117H176N32O32SPurity:Min. 95%Molecular weight:2,574.91 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molAbz-Gly-Ile-Val-Arg-Ala-Lys(Dnp)-OH
CAS:<p>Abz-Gly-Ile-Val-Arg-Ala-Lys(Dnp)-OH is a protease inhibitor that has been shown to inhibit the activity of proteinases, such as collagenase, elastase and cathepsin G. It also inhibits the growth of leishmania parasites. Abz-Gly-Ile-Val-Arg-Ala-Lys(Dnp)-OH was also found to be potent in inhibiting the proteolytic activity of cancer cells. The inhibition is due to its ability to form tight complexes with the active site of enzymes such as trypsin and chymotrypsin. This compound has potential for use in animal experiments and in vitro assays.</p>Formula:C41H61N13O12Purity:Min. 95%Molecular weight:928 g/molH-Arg-Ala-OH acetate salt
CAS:<p>H-Arg-Ala-OH acetate salt (HAA) is a histidine analogue that has been found to have physiological function as an endogenous substrate for serine protease. HAA acts as a competitive inhibitor of the serine protease enzyme by binding to the active site serine in the active site. The molecule is a disulfide bond and can be synthesized by the microorganism Corynebacterium glutamicum. This salt was extracted from yellowtail and found to inhibit corynebacterium glutamicum. X-ray absorption studies showed that the molecule contains a single amino acid, which is an analog of histidine.</p>Formula:C9H19N5O3Purity:Min. 95%Molecular weight:245.28 g/molWRW4
CAS:<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H65N15O6Purity:Min. 95%Molecular weight:1,104.27 g/molHepcidin-24 (human) trifluoroacetate salt
<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C109H165N33O28S9Purity:Min. 95%Molecular weight:2,674.28 g/mol(Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat)
CAS:<p>Please enquire for more information about (Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C162H254N50O36Purity:Min. 95%Molecular weight:3,478.07 g/molZ-Lys-Arg-pNA·2 HCl
CAS:<p>This is a new inhibitor of phosphatase 2A (PP2A) that is in the form of a zwitterion. The compound has been shown to have significant inhibitory activity on PP2A in vitro and in vivo, with an IC50 of 0.12 μM and 0.28 μM respectively. The compound also showed significant inhibitory activity against PP2A-related enzymes, such as PP1, PP2B, and PP4. Z-Lys-Arg-pNA·2 HCl has been shown to be effective at inhibiting phosphatases in plants, including seed germination and seedling growth.</p>Formula:C26H36N8O6·2HClPurity:Min. 95%Molecular weight:629.54 g/molAbz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H77N17O13Purity:Min. 95%Molecular weight:1,124.25 g/molMAGE-3 Antigen (168-176) (human) acetate salt
CAS:<p>Please enquire for more information about MAGE-3 Antigen (168-176) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C48H71N11O15Purity:Min. 95%Molecular weight:1,042.14 g/molZ-Glu-Tyr-OH
CAS:<p>Z-Glu-Tyr-OH is a disulfide bond with a cavity. It is soluble in acidic solutions and has a cationic surface. Z-Glu-Tyr-OH is an enzyme inhibitor that blocks the activity of α subunit of protein kinase C, which is involved in intracellular signal transduction pathways. The inhibition of this enzyme may lead to apoptosis, or programmed cell death. Z-Glu-Tyr-OH also inhibits fatty acid synthesis by blocking the activity of hydroxylase enzymes, such as 3β-hydroxysteroid dehydrogenase and 17α-hydroxylase. This compound has been shown to inhibit indole-3-propionic acid production by inhibiting the kinetic and sephadex g-100 activities of the enzyme indoleamine 2,3 dioxygenase.</p>Formula:C22H24N2O8Purity:Min. 95%Molecular weight:444.43 g/molAngiotensin II acetate salt
CAS:Controlled Product<p>Angiotensin II is a hormone that is produced in the kidneys and acts on the blood vessels, heart, and other tissues. It is also known as angiotensin II acetate salt H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH acetate salt. Angiotensin II can increase blood pressure by constricting blood vessels and causing the release of aldosterone from the adrenal glands. This hormone also causes smooth muscle contraction in various organs, including the intestines. The synthesis of angiotensin II occurs through two different pathways: one involving renin and another involving prorenin. The renin pathway begins with renin converting angiotensinogen into angiotensin I, which is then converted to angiotensin II by angiotensins I converting enzyme (ACE). Angiotensin II has been shown to increase protein phosphorylation in myosin, leading to increased</p>Formula:C50H71N13O12·xC2H4O2Purity:Min. 95%Color and Shape:White SolidMolecular weight:1,046.18 g/molFmoc-Tyr(PO3(MDPSE)2)-OH
CAS:<p>Please enquire for more information about Fmoc-Tyr(PO3(MDPSE)2)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H54NO8PSi2Purity:Min. 95%Molecular weight:932.15 g/molBoc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt
CAS:<p>Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt is a synthetic substrate that is used in enzyme assays. The hydrolysis of the peptidyl ester bond by the enzyme results in release of AMC and an unstable intermediate, which reacts with AMC to form a stable fluorescent product. This product can be detected using various chromatographic techniques. Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt has been shown to be an effective anticoagulant for blood clotting and it is also used as a second order rate constant in the determination of coagulation factors.</p>Formula:C34H52N8O10Purity:Min. 95%Molecular weight:732.82 g/molBuccalin trifluoroacetate salt
CAS:<p>Buccalin is a cholinergic pharmaceutical drug that has been shown to have metabolic, growth factor, and chemotactic activities. It has been used in the treatment of various autoimmune diseases and infectious diseases. The mechanism of action for buccalin is unknown. Buccalin has been shown to have receptor activity in a variety of diagnostic agents such as monoclonal antibodies and fatty acids. It binds to acetylcholine receptors at the neuromuscular junction, leading to activation of muscle fibers by acetylcholine release from nerve endings.</p>Formula:C45H72N12O15SPurity:Min. 95%Molecular weight:1,053.19 g/molGRF (1-29) amide (rat)
CAS:<p>Growth hormone-releasing factor (GRF) is a peptide fragment of amino acids 1–2 from GHRH (growth hormone-releasing hormone). This 1-29 region is the shortest fully functional fragment of GHRH. GRF is also known as sermorelin. Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH-R), and acts as a surrogate for GHRH, causing growth hormone secretion.human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2rat: H-HADAIFTSSYRR I LGQLYARKLLHEIMNR-NH2</p>Formula:C155H251N49O40SPurity:Min. 95%Molecular weight:3,473.02 g/mol(d(CH2)51,D-Ile2,Ile4,Arg8,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disulfide bond)
CAS:<p>Please enquire for more information about (d(CH2)51,D-Ile2,Ile4,Arg8,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H79N13O10S2Purity:Min. 95%Molecular weight:1,086.38 g/mol5-Methoxy-3,4-dihydro-2H-pyrrole
CAS:<p>5-Methoxy-3,4-dihydro-2H-pyrrole is a chemical compound that contains a pyrrole ring. It can be found in the form of dehydrogenation and intramolecular hydrogen. 5-Methoxy-3,4-dihydro-2H-pyrrole has been shown to have antibacterial effects against Mycobacterium tuberculosis and other bacteria. 5-Methoxy-3,4-dihydro-2H-pyrrole also reacts with nitroacetate to form an aziridine, which is an intermediate in the synthesis of several pharmaceuticals. This chemical compound is used in the preparation of bipyrrole compounds such as naphthalene and alicyclic compounds such as nitrophenols.</p>Formula:C5H9NOPurity:Min. 95%Molecular weight:99.13 g/mol(Des-Lys38)-M65 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Lys38)-M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C199H314N62O60S5Purity:Min. 95%Molecular weight:4,695.33 g/molH-Glu-Gly-Arg-pNA acetate salt
CAS:Controlled Product<p>Please enquire for more information about H-Glu-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H28N8O7Purity:Min. 95%Molecular weight:480.48 g/mol3-(4-Methylphenyl)-5-(trifluoromethyl)pyrazole
CAS:<p>Please enquire for more information about 3-(4-Methylphenyl)-5-(trifluoromethyl)pyrazole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H9F3N2Purity:Min. 95%Molecular weight:226.2 g/molZ-Asu (OtBu)-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Z-Asu (OtBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H29NO6·C12H23NPurity:Min. 95%Molecular weight:560.77 g/mol2-Phenyl-5-benzimidazolesulfonic acid
CAS:<p>2-Phenyl-5-benzimidazolesulfonic acid is a chemical compound that has been shown to have stability in vitro. It was used as a skin cancer treatment in the past, but is now mainly used as an analytical reagent. It has been shown to be effective against coumarin derivatives and enzyme activities. 2-Phenyl-5-benzimidazolesulfonic acid can be used as a chelating agent for metals and also binds to zirconium oxide, which is one of the materials used in radiation shielding. The compound can also be used for wastewater treatment and polymerase chain reaction (PCR) analysis. This compound can be synthesized using sodium salts, solid phase microextraction (SPME), and sodium citrate in order to form the benzene ring. The synthesis can then be completed by adding two phenyl groups onto the benzene ring with various reactions such as transfer reactions or radiation. Finally,</p>Formula:C13H10N2O3SPurity:Min. 95%Molecular weight:274.3 g/molThrombospondin-1 (1016-1023) (human, bovine, mouse)
CAS:<p>Please enquire for more information about Thrombospondin-1 (1016-1023) (human, bovine, mouse) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H81N13O10SPurity:Min. 95%Molecular weight:1,128.39 g/mol(Boc-Tyr1,D-Ala2)-Leu-Enkephalin-Lys Boc-Tyr-D-Ala-Gly-Phe-Leu-Lys-OH
CAS:<p>Please enquire for more information about (Boc-Tyr1,D-Ala2)-Leu-Enkephalin-Lys Boc-Tyr-D-Ala-Gly-Phe-Leu-Lys-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C40H59N7O10Purity:Min. 95%Molecular weight:797.94 g/molNeuropeptide Y (1-24) amide (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (1-24) amide (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H170N30O40SPurity:Min. 95%Molecular weight:2,656.84 g/molAmyloid Bri Protein (1-23) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Bri Protein (1-23) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C116H175N31O35S2Purity:Min. 95%Molecular weight:2,627.95 g/molGRP (14-27) (human, porcine, canine) trifluoroacetate salt
CAS:<p>GRP (14-27) is a synthetic peptide that has an inhibitory effect on the growth of pancreatic cancer cells. It also inhibits the development of primary tumors in hamsters and inhibits tumor metastasis. GRP (14-27) binds to the cell surface receptor on T cells, which is responsible for mediating immune responses against tumors. GRP (14-27) has been shown to suppress tumor growth through immunoreactivity and has been found to be effective against a variety of cancers when used as an adjuvant therapy.</p>Formula:C75H110N24O16S2Purity:Min. 95%Molecular weight:1,667.96 g/mol(Lys18)-Pseudin-2 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys18)-Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C122H203N37O32Purity:Min. 95%Molecular weight:2,700.15 g/molH-Asp(Phe-OH)-OH
CAS:<p>Aspartame is a synthetic, sweetener that is used as a sugar substitute in diet products. It was discovered by accident in 1965 when James Schlatter, a chemist of G.D. Searle Company, was testing an anti-ulcer drug and l-phenylalanine methyl ester on his finger and tasted the sweetness on his fingers. Aspartame is composed of two amino acids: aspartic acid and phenylalanine. The aspartic acid is made up of a carboxylic acid group with an amide functional group. Aspartame can be found in many foods including chewing gum and diet sodas. It has been shown to have no carcinogenic effects or adverse effects on reproduction function in animal studies.</p>Formula:C13H16N2O5Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:280.28 g/molFmoc-D-Thr(tBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Thr(tBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Biphalin trifluoroacetate salt (
CAS:<p>Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is a peptide hormone. It has been shown to be an opioid that binds to the μ and δ opioid receptors and inhibits the production of inflammatory mediators. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt has also been shown to have neuroprotective effects. This drug has low potency and can only be used in vivo models. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is not active against skin cancer cells, but does show activity against other types of cancer cells.</p>Formula:C46H56N10O10Purity:Min. 95%Molecular weight:909 g/molAc-Leu-pNA
CAS:<p>Ac-Leu-pNA is a peptide that is isolated from pyrococcus furiosus. It has the ability to inhibit serine proteases, including trypsin and chymotrypsin, by forming hydrogen bonds with their active site. Ac-Leu-pNA also inhibits the activity of the enzyme proteasome, which breaks down proteins in cells. This inhibition is due to its ability to bind to the ubiquitin-proteasome system (UPS) and block the enzymatic reaction. Ac-Leu-pNA has been shown to have a blood pressure lowering effect in humans.</p>Formula:C14H19N3O4Purity:Min. 95%Molecular weight:293.32 g/molH-Leu-Ser-Lys-Leu-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H41N5O6Purity:Min. 95%Molecular weight:459.58 g/molFmoc-Tyr(tBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Tyr(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Cyclo(-D-Trp-Tyr)
CAS:<p>Cyclo(-D-Trp-Tyr) is a cyclic peptide that is produced by the fungus Microbispora sp. It has been shown to inhibit the growth of Staphylococcus aureus, as well as other bacteria, fungi and cancer cells. Cyclo(-D-Trp-Tyr) binds to the ribosomal RNA in these cells and inhibits protein synthesis. The peptide does not bind to subtilisin or bgc-823, but does bind to lung fibroblasts and leukemia cells.</p>Formula:C20H19N3O3Purity:Min. 95%Molecular weight:349.38 g/molOsteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Osteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H41N9O8Purity:Min. 95%Molecular weight:619.67 g/molNeuropeptide FF (5-8) acetate salt
CAS:<p>Please enquire for more information about Neuropeptide FF (5-8) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H39N9O5Purity:Min. 95%Molecular weight:545.63 g/molH-Leu-Trp-Met-Arg-OH
CAS:<p>Histidine is a non-essential amino acid that is found in all living cells. It is a precursor of histamine and can be converted to tryptophan by decarboxylation. Histidine has been found to be essential for growth in some bacteria and yeast, but not in higher plants or animals. The formyl group of histidine can be oxidized to a sulfoxide or reduced to a formyl group. Histidine residues are often found in the protein matrix of proteomic samples, but can also be used as an analyte. The two most common methods for the detection of histidine are matrix-assisted laser desorption/ionization mass spectrometry (MALDI MS) and matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI TOF MS). These methods allow for the minimization of background interference from other molecules present in the sample, such as tryptophan residues.</p>Formula:C28H44N8O5SPurity:Min. 95%Molecular weight:604.77 g/molFmoc-Gly-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Gly-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ac-Thr-Leu-Asn-Phe-OH
CAS:<p>Ac-Thr-Leu-Asn-Phe-OH is a tetrapeptide that is synthesized from the amino acid sequence of human immunodeficiency virus (HIV) protease. It has been shown to inhibit HIV protease and prevent the cleavage of polypeptides, thereby preventing viral replication. The peptide is synthesized by reacting aspartyl with L-leucine in the presence of N,N′-dicyclohexylcarbodiimide and pyridine. Ac-Thr-Leu-Asn-Phe-OH was found to be resistant to proteases and has a constant molecular weight.</p>Formula:C25H37N5O8Purity:Min. 95%Molecular weight:535.59 g/molH-Ala-Ala-pNA hydrochloride salt
CAS:<p>Please enquire for more information about H-Ala-Ala-pNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16N4O4Purity:Min. 95%Molecular weight:280.28 g/molAcetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H85FN16O13Purity:Min. 95%Molecular weight:1,365.51 g/molH-Ala-Gly-Gly-Gly-Gly-OH
CAS:<p>Please enquire for more information about H-Ala-Gly-Gly-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19N5O6Purity:Min. 95%Molecular weight:317.3 g/molZ-Leu-Arg-AMC HCl
CAS:<p>Please enquire for more information about Z-Leu-Arg-AMC HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H38N6O6Purity:Min. 95%Molecular weight:578.66 g/molAcetyl-Angiotensin I Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH
CAS:<p>Please enquire for more information about Acetyl-Angiotensin I Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H91N17O15Purity:Min. 95%Molecular weight:1,338.51 g/mol2-Methoxy-5-[[(phenylmethyl)sulfonyl]methyl]benzenamine
CAS:<p>3-Amino-4-methoxybenzyl sulphone is a high quality, versatile building block that is used in the synthesis of complex compounds. It is a reagent that can be used for reactions such as the coupling of amines and carboxylic acids. 3-Amino-4-methoxybenzyl sulphone is also useful in the synthesis of pharmaceuticals and speciality chemicals. The compound has been shown to react with other substances, such as thiols and alcohols, to form new materials with interesting properties.</p>Formula:C15H17NO3SPurity:Min. 95%Color and Shape:PowderMolecular weight:291.37 g/molTrypsin-Modulating Oostatic Factor (Neobelliera bullata)
CAS:<p>Proctolin is a peptide hormone that regulates the growth of the ovary. Proctolin has been found to be a proteolytic molecule that specifically cleaves at the carboxy-terminal end of the protein substrate. It also has inhibitory effects on the activity of carboxypeptidase, an enzyme involved in the digestion and absorption of proteins. Proctolin has been shown to modulate biological studies, such as nitrogen atoms and sequences, which may be due to its ability to regulate and stimulate biosynthesis.</p>Formula:C29H46N10O10Purity:Min. 95%Molecular weight:694.74 g/molDynorphin A (porcine 1-13) - acetate salt
CAS:<p>Dynorphin A (1-13) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys is a peptide that is found in the brain and spinal cord. It is an agonist of opioid receptors, which are involved in pain relief, as well as motor control. Dynorphin A (1-13) H has been shown to inhibit acetylcholine release, which may be due to its ability to bind to kappa opioid receptors. Dynorphin A (1-13) H is also known to bind to κ opioid receptors, where it inhibits locomotor activity and induces analgesia.</p>Formula:C75H126N24O15Purity:Min. 95%Color and Shape:PowderMolecular weight:1,603.96 g/molZ-Phe-Phe-Phe-OH
CAS:<p>Z-Phe-Phe-Phe-OH is an organic solvent that is homogeneous, has low solubility and a high boiling point. The epimerization of this compound can be achieved through the use of experimental methods. Z-Phe-Phe-Phe-OH is used in medicinal solvents as well as fields such as pharmacology and chemistry. This compound also has efficient methods for producing it and yields are detectable. There are also no residues from this compound.</p>Formula:C35H35N3O6Purity:Min. 95%Molecular weight:593.67 g/molKemptide trifluoroacetate salt
CAS:<p>Kemptide is a substrate molecule that has been shown to inhibit the enzyme activity of some protein kinases. Kemptide is a 3-amino acid peptide that contains the amino acids L-leucine, L-arginine, and L-arginine. It was originally isolated from an extract of human brain tissue and has been shown to inhibit the activity of protein kinase C (PKC), phosphorylase kinase, and glycogen synthase kinase 3β in vitro assays. Kemptide also inhibits the expression of genes encoding PKCα1, PKCα2, PKCδ, PKCε, PKCγ1, PKCγ2, PKCζ in t84 cells. The inhibition of these genes suggests that kemptide may be useful as a drug candidate for inhibiting protein kinases in vivo.</p>Formula:C32H61N13O9·xC2HF3O2Purity:Min. 95%Molecular weight:771.91 g/molSuc-Ala-Ala-Pro-Nva-pNA
CAS:<p>Suc-Ala-Ala-Pro-Nva-pNA is a tetrapeptide. It is one of the most potent trypsin inhibitors that has been identified to date and it has been shown to inhibit pancreatic trypsin with a potency similar to that of the synthetic inhibitor benzamidine. Suc-Ala-Ala-Pro-Nva-pNA binds to the active site of trypsin, preventing proteolysis of peptides. This inhibition is reversible because it does not bind covalently to any other sites on the enzyme. Suc-Ala-Ala-Pro-Nva-pNA inhibits proteases by binding to their active site and blocking access by the substrate. The binding occurs through noncovalent hydrophobic interactions with amino acids in the active site, including valine, leucine, phenylalanine, and methionine.</p>Formula:C26H36N6O9Purity:Min. 95%Molecular weight:576.6 g/molFA-Gly-Leu-OH
CAS:<p>FA-Gly-Leu-OH is a peptidase that catalyzes the hydrolysis of an amide bond in a peptide or protein. It has been shown to be active with acid sequences, as well as transpeptidation, which involves the transfer of a terminal amino acid from one peptide chain to another. FA-Gly-Leu-OH is also involved in the synthesis of proteins and peptides. This enzyme has high hydrolase activity and can hydrolyze most substrates at neutral pH values.</p>Formula:C15H20N2O5Purity:Min. 95%Molecular weight:308.33 g/molH-Gly-Gly-Arg-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H25N7O5Purity:Min. 95%Molecular weight:359.38 g/molBoc-Ala-Ala-Asp-pNA
CAS:<p>Boc-Ala-Ala-Asp-pNA is a peptide that has been shown to have cytotoxic activity against the leukemia cell line, basophilic leukemia (BL). It also inhibits hemolytic activity and cytolysin production by staphylococcus. This peptide is expressed in the sequence of Boc-Ala-Ala-Asp and is composed of 20 amino acids. The Boc-Ala sequence has been shown to be involved in apoptosis, while Asp and pNA are responsible for inhibiting hemolytic activity. Functional assays have demonstrated that this peptide has a strong inhibitory effect on the growth of bacteria, including strains of subtilis and hybridization.</p>Formula:C21H29N5O9Purity:Min. 95%Molecular weight:495.48 g/molBoc-Asp(OBzl)-chloromethylketone
CAS:<p>Boc-Asp(OBzl)-chloromethylketone is a synthetic molecule that is immunoreactive with gp120, the virus protein. It has been shown to inhibit the proliferation of human neuroblastoma cells and induce cell death. This compound also has an effect on cytokine production in vitro. This drug is currently being studied as a potential treatment for HIV infection. Boc-Asp(OBzl)-chloromethylketone binds to the receptor type and viral type, which are essential for the virus life cycle and induces antibody production in vivo.</p>Formula:C17H22ClNO5Purity:Min. 95%Molecular weight:355.81 g/mol3-Methylbenzofuran-2-carboxylic acid
CAS:<p>3-Methylbenzofuran-2-carboxylic acid is a dianion that binds to the cell membrane and inhibits bacterial growth. This compound has been shown to be active against bacteria at low concentrations. 3-Methylbenzofuran-2-carboxylic acid has been used as an antibacterial agent for the treatment of gram-negative bacteria such as Escherichia coli and Proteus mirabilis. It also inhibits the growth of gram-positive bacteria including Staphylococcus aureus, Streptococcus pneumoniae, and Enterococcus faecalis. The reaction temperature required for the synthesis of this compound is high, but it can be prepared at lower temperatures by using anhydrous acetonitrile in place of hydrochloric acid.</p>Formula:C10H8O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:176.17 g/molH-Gly-Ala-NH2·HCl
CAS:<p>Please enquire for more information about H-Gly-Ala-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H11N3O2·HClPurity:Min. 95%Molecular weight:181.62 g/molγ-L-Glutamyl-α-naphthylamide monohydrate
CAS:<p>Gamma-L-glutamyl-alpha-naphthylamide is an enzyme that catalyzes the conversion of L-glutamic acid to L-glutamate. It is expressed in red blood cells, human liver, and human serum. Gamma-L-glutamyl-alpha-naphthylamide has been shown to have various specificities for different tissues and isoenzymes. This enzyme also has immunoassay procedures that are used to detect it in tissues or cells. These assays use monoclonal antibodies or solubilized gamma-L-glutamyl-alpha-naphthylamide molecules as detection agents.</p>Formula:C15H16N2O3•H2OPurity:Min. 95%Color and Shape:PowderMolecular weight:290.31 g/molFmoc-Sar-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Sar-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ac-Tyr-Val-Ala-Asp-2,6-dimethylbenzoyloxymethylketone
CAS:<p>Ac-Tyr-Val-Ala-Asp-2,6-dimethylbenzoyloxymethylketone is a potent transcriptional regulator that can be used to treat breast cancer. Ac-Tyr-Val-Ala-Asp-2,6-dimethylbenzoyloxymethylketone binds to estrogen receptor and prevents the binding of estrogen to its receptor. This leads to the death of cancer cells by inhibiting the function of bcl family proteins. Acetylation of this compound at C8, C10, and C17 positions increases its potency in vivo. In addition, Acetylated TAVADM can inhibit pancreatic cancer cell growth by activating signal transducer and activator of transcription 3 (STAT3) and inhibiting the activity of bcl family proteins such as BCL2 and BCLXL. Acetylated TAVADM has also been shown to have antiapoptotic</p>Formula:C33H42N4O10Purity:Min. 95%Molecular weight:654.71 g/molAngiotensin I/II (3-7)
CAS:<p>Angiotensin I/II (3-7) H-Val-Tyr-Ile-His-Pro-OH is an antagonist of the angiotensin II receptor. It has been shown to be a cognitive enhancer by statistically improving treatments for behavioural problems in rats and mice. Angiotensin I/II (3-7) H-Val-Tyr-Ile-His-Pro-OH has also been shown to inhibit nicotinic acetylcholine receptors, which are involved in mediating the effects of neurotransmitters on muscle cells. This agent also inhibits angiotensin II receptors, leading to vasodilation and reduced blood pressure. The mechanism of action is not yet clear but may involve inhibition of protein kinase C. In preclinical studies, it has been shown that this drug facilitates behavioural effects such as memory retention and motor performance in rats when given before treatment with peptides such as substance P or calcitonin gene related pept</p>Formula:C31H45N7O7Purity:Min. 95%Molecular weight:627.73 g/mol

